KEGG   Danio rerio (zebrafish): 404626Help
Entry
404626            CDS       T01004                                 

Gene name
map3k12, zgc:77370
Definition
mitogen-activated protein kinase kinase kinase 12 (EC:2.7.11.25)
Orthology
K04423  
mitogen-activated protein kinase kinase kinase 12 [EC:2.7.11.25]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Module
MAPK (JNK) signaling
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    404626 (map3k12)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     404626 (map3k12)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   404626 (map3k12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
9
AA seq 856 aa AA seqDB search
MACVHEQHAPSPSLSGFTTPLSDPPFCRPDPEVPASTPDTELTPTQCVLRNVLSIDPVGG
GSGTHSNSPTLSDEPTNFSNSVLKLQEGGAEGGAVRSQADSFRLQPGGGGFLEGLFGCLK
PVWTMIGKAYSTEHKQSQEECWEVPFEEISELQWVGSGAQGAVFLGKFHGEEVAVKKVRD
IKETEIKHLRKLKHPNIITFKGVCTQAPCYCILMEYCAQGQLYEVLRAGRKITPCLLVDW
AMGIAGGMNYLHLHKIIHRDLKSPNMLITHDDLVKISDFGTSKELRDKSTKMSFAGTVAW
MAPEVIRNEPVSEKVDIWSFGVVLWEMLTGEIPYKDVDSSAIIWGVGNNSLQLPLPDSCP
DGFKILLRQCWNCKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWREEVKQHFEK
IKSEGTCLHRLDEELINRRREELRHALDIREHYERKLERANNLYMELNAVMLQLELKEKE
LLRREQCLDKKYPGLFKHHTSNTVDKLIKKRSAPQKLPPHGKRPDLLRSEIILPKMDAGV
LQVTVPPCSNRGSTSPSRARRVKTRHRRGGRGSSGDLSGPKHPSAPASREREPVANTPPP
AAPIAESVSGSTMREGQLEPPPLKLDETPPRSDTASEDAASLPFSSSPDSPCCGRSGAVG
RPQAEEREEGPGAVRLPRGSSGSHLTPSAILYRAAITRKQRRGVSSEEEEGEVDSEVELP
RRRRPTSITKCQSVSTFSSENLSVSEGEEGHTTDHSHSGTPDVVSTNTDERLDDRSDDLI
SQGSEIPVDITDPTLSEREAAALEQERANFDLEQNILETRALCEDSDCDSAELDQSGSGE
PSRPPSAGGWGQGPQN
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggcttgtgtccatgagcagcatgccccatccccgtccctctccggcttcaccacgccg
ctctccgacccgcccttctgccgtcctgaccctgaggttccggccagcaccccggacact
gagcttaccccgacccagtgcgtgctgcgtaacgtgctgtccatcgaccccgtgggcggc
ggcagtggcacccacagcaacagccccaccctgagtgatgagcccaccaacttctccaac
agcgtgctgaagctgcaggagggtggagcggagggcggagcggtgcgcagccaggccgac
agcttcagactgcagcccggcggaggaggcttcctggaaggcctgttcggctgcctgaag
cccgtgtggaccatgatcggaaaagcctactctactgaacacaagcaaagccaggaggag
tgctgggaggtgccgttcgaggagatctcggagctgcagtgggtgggcagcggcgctcag
ggcgcagtcttcctgggcaagtttcatggagaggaagtggcagtgaagaaagtcagagac
atcaaggagacggagatcaaacacctgcgcaaactcaaacatcccaacatcatcaccttc
aagggtgtgtgtacacaggctccgtgttactgcatcctcatggagtactgtgcgcagggt
cagctgtatgaggtgctgcgtgcgggccggaagatcacgccgtgcctgctggtggactgg
gccatgggcatcgccggcggcatgaactacctgcacctgcacaagatcatccacagagac
ctcaagtctccaaatatgctgatcacacacgatgacctggtgaagatctccgacttcggc
acgtctaaagagctcagggataaaagcaccaagatgtcgttcgctggcaccgtggcctgg
atggcaccggaggtgatacggaacgaacctgtgtctgagaaagtggacatctggtcattc
ggtgtggtgctgtgggagatgctgaccggggagatcccctataaagatgtggactcgtct
gctatcatttggggtgtcggaaacaacagcttgcagctccctcttccagacagctgccct
gatgggttcaagatcctgctcagacagtgctggaactgtaagcccaggaacaggccatcg
ttccggcagattctgcttcatctggacatcgcctccgcagacgtgctgtccaccccacag
gagacgtactttaagtctcaggcggagtggcgagaggaggtgaagcaacactttgagaag
attaaatctgagggcacgtgtctgcaccgtctggatgaagagctgatcaaccggcgccga
gaagaactcaggcatgcgctggacatcagagagcactacgagaggaagctggagagggcc
aataacctctacatggagctcaatgcagtaatgcttcagctggagctcaaggagaaggag
ctgctcaggagggaacagtgtctggataagaagtaccctggtctgttcaagcatcacacc
tcaaacacagtggacaaactcatcaagaagagaagcgccccgcagaaactgccgcctcac
ggcaagagaccggacctcctgcgctcagagatcatcctccccaagatggatgccggagtg
ctgcaagtgactgtcccgccatgctcaaaccgaggatctacctcacccagtcgggcacgc
agggtcaaaacccgtcaccggcggggcggcagggggagcagcggggatctgtcgggaccc
aagcacccttctgcccctgccagccgagagcgcgagcctgtggccaacactcctccgcct
gctgcgcctatcgccgagagcgtttccggatccaccatgagggagggtcagctggagccg
ccgccactgaagctggacgagactccgcccagaagtgacacggccagtgaggacgcggca
tcattgcccttctccagcagcccggactccccctgttgcgggcggagcggtgccgtgggc
agaccacaggcggaggagcgggaggagggccccggggctgtgcggctgcccagaggatcc
agcgggagccacctgacgccctccgccatactctaccgcgctgctatcacacgcaaacag
cgccgtggtgtttcctcagaagaggaagagggcgaggtggacagtgaggtggaattacca
agaagacgacggccaaccagtataaccaagtgccaatcagtgtccacgttcagctcagag
aacctgtcggtttcagaaggcgaggagggccacaccaccgaccattcccacagcgggact
ccagacgtggtcagcaccaacactgacgagcggctggacgaccgcagcgatgacctgatc
tcgcagggctccgagatccctgtggacatcacagacccaaccctgtctgaacgagaggcc
gctgccctcgaacaggaaagggccaactttgacctggaacaaaacatcctggagacgcgt
gcgctctgtgaggactcggactgtgacagtgctgaactggaccagtctggcagcggagag
ccgagccgtcccccgagtgctggaggatggggccagggtccacaaaactga

DBGET integrated database retrieval system