KEGG   Danio rerio (zebrafish): 404731Help
Entry
404731            CDS       T01004                                 

Gene name
uros, wu:fd13d11, zgc:110240
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dre  Danio rerio (zebrafish)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dre00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
12
AA seq 262 aa AA seqDB search
MKVLLLKEPRESESEADPYIKELASCGHTATLIPALSFRFVSLNELSERLFQPERFGGLI
FTSPRAVEAVKTSLESQKLRGKWDAVKDKWNTKSVYVVGKATASLVVDLGLRPLGEDSGT
ADALALLILQRENPDIEPLFFPCGSIKREVLPTALRNSHIPLETLTVYQTSEHPDLQKNI
SDYFTQQGVPACVAFFSPSGVSFCLDLLKDLSGCQLEQIKFASIGRTTADALQARGLTVS
CCAEKPTAKHLAIAITQALRDL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgcttcttctgaaagagccgagagagagtgaaagtgaagcagacccttatatt
aaggagctggcctcatgtggacacacagcgactctcattcctgctctgtccttcagattc
gtctctctaaatgagctttctgagcggctctttcaacctgagaggtttggaggtctgatc
ttcaccagtccccgagccgtggaggccgtgaagacgagcttagagtcgcagaaactgaga
ggcaaatgggatgcagtaaaagacaaatggaatacaaagtcggtttatgttgtcggaaaa
gccacagcatctttggttgtagatctgggtttgcgtcctctgggtgaagattctggaacc
gcagacgcactcgctctactcatcctacagagagaaaatccagacattgagccgcttttc
tttccctgcggctccatcaagcgtgaagttctgcccaccgcactgagaaacagccatatt
cctctggagactctgactgtctatcaaacatctgaacatcctgatctgcagaagaacatc
tctgactacttcactcagcagggtgtcccagcatgtgtggcgttcttcagtccgtcaggt
gtgtccttctgtctggatctgctgaaagacctctcaggatgtcagctggagcagataaag
tttgcctctattggacggacaacagctgatgctctgcaggctcgtggattgacggtcagc
tgctgcgcggagaaacccaccgccaaacacctcgccatcgccatcacacaggccctgcgt
gacctctga

DBGET integrated database retrieval system