KEGG   Danio rerio (zebrafish): 405769Help
Entry
405769            CDS       T01004                                 

Gene name
syk
Definition
(RefSeq) tyrosine-protein kinase SYK
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    405769 (syk)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     405769 (syk)
Protein kinases [BR:dre01001]
 Non-receptor tyrosine kinases
  SYK family
   405769 (syk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 405769
NCBI-ProteinID: NP_998008
ZFIN: ZDB-GENE-040702-3
Ensembl: ENSDARG00000008186
Vega: OTTDARG00000030778
UniProt: A0A0R4IBB3
Position
10
AA seq 585 aa AA seqDB search
MVDKVHLLPYFFGNITREESEVYLQQGGSGDGLYLLRQSRSFLGGYALSLSYGRQFYHYT
IERELNDTYAIAGGKSHRTPIDVINYHSQESDGLICLLKKPFHRPRGTEPKVGPFEDLKE
QLIRQYVEQTWNLKGSALDQAIISQRPQLEKLIATTAHEKMPWFHGKIDREDSELRLLNT
SRVNGKFLIRQRENSGRNESYALCLLHNNQVMHYRIDKDRAGKLSIPDGKKFDTLWQLVE
HYSYKPDGLLRVLTETCPRPSHHSEGSAENPYKITPNGKDDYSKQGNFLDSAMPMDTQVY
ESPYADPDELRSTKVNRSDLTLEDGELGSGNFGTVLRGVYQMKKTQKVVAVKILKNDDDN
AAVKDEMLREANVMQQLDNPYIVRMIGICEAENLMLVMELAELGPLHKFLQKNKHITVKN
LTELVHQVSMGMKYLEEHNFVHRDLAARNVLLVTQHYAKISDFGLSKALTEDENYYKAKG
HGKWPLKWYAPECMNYLKFSSKSDVWSFGVLMWEAFSYGQKPYKGMKGNEVIQMIENGQR
MSAPPDCPPEMYDLMKKCWTYKPDERPGFSVVEPRLRHYYYDISQ
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggtggataaggtgcatttgctgccgtacttcttcggcaacatcacccgcgaggagtcc
gaggtttatttgcaacagggaggatcaggagacggcctgtacctgctccgccagagccgc
agtttcctcggcggctatgccctgtcactgtcctacggccgccagttctaccactatacc
atagagagggagctgaacgacacctacgccatcgctggaggcaaatctcaccggacgcct
atagatgtgatcaactaccactctcaggagtctgacggcctcatctgcctgctgaagaag
ccctttcaccggccccgcggcacagagcctaaagtcgggccctttgaagacctgaaggag
cagctcatccggcagtatgtcgagcaaacctggaatttaaagggttcagcgctggaccag
gccatcatcagccagaggcctcagctggagaaactcatcgccacaacagcacatgagaag
atgccctggtttcacggaaagatagatcgcgaggattcagagctgcgtttgctcaatacc
tcacgggtcaacggcaaatttctaatcagacaaagagaaaacagtggcagaaacgagtcc
tatgcgctgtgtctcctgcataacaatcaagtcatgcactatcgcattgataaggacagg
gctggaaagctttccattcctgatggcaagaagttcgacacactatggcagctggtagaa
cactattcttacaagcctgacggcctgctccgcgtgctcaccgagacctgcccgagacca
tcacatcattctgagggttctgctgaaaacccttataaaatcacacctaacggcaaagac
gactattccaagcagggtaatttcttggattcagctatgccaatggacacacaggtgtat
gaaagtccatatgcagatcccgatgagctgcgatcgactaaagtgaaccgcagtgatctg
actctggaagatggagaactaggctcagggaactttggcactgtcctgagaggtgtttac
cagatgaaaaaaacacagaaggttgttgctgttaagatcctaaagaatgatgacgataat
gcagcagtaaaggacgagatgttgcgggaggcgaacgtcatgcagcagctggataatcca
tacatagtccgcatgattgggatctgtgaagcggaaaaccttatgctggttatggagctc
gctgaactggggccgcttcacaagtttctgcagaagaacaagcacatcactgtgaagaac
ctcacagagctggttcatcaggtgtcaatgggcatgaaatatctggaagagcacaacttt
gttcacagagatcttgcagccaggaatgtgcttttagtcactcagcattatgcaaaaatc
agcgactttggcctctctaaagccctgacagaggatgagaactattacaaggccaaaggt
catggtaaatggccgttgaaatggtacgcacccgagtgcatgaactacttgaaattttct
tcaaagagtgacgtgtggagctttggagtcctgatgtgggaggctttttcatacggacag
aaaccatacaagggcatgaagggaaatgaagtcatccaaatgattgagaacggacagcgg
atgtccgcaccgcccgactgcccacctgagatgtacgacctcatgaagaaatgctggaca
tacaagccagatgagagacctggattttctgtagtcgaacccagactgcggcattactat
tacgacatttctcagtga

DBGET integrated database retrieval system