KEGG   Danio rerio (zebrafish): 405769Help
Entry
405769            CDS       T01004                                 

Gene name
syk
Definition
(RefSeq) spleen tyrosine kinase
  KO
K05855  
spleen tyrosine kinase [EC:2.7.10.2]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     405769 (syk)
Protein kinases [BR:dre01001]
 Tyrosine protein kinases
  Syk family
   405769 (syk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
10
AA seq 585 aa AA seqDB search
MVDKVHLLPYFFGNITREESEVYLQQGGSGDGLYLLRQSRSFLGGYALSLSYGRQFYHYT
IERELNDTYAIAGGKSHRTPIDVINYHSQESDGLICLLKKPFHRPRGTEPKVGPFEDLKE
QLIRQYVEQTWNLKGSALDQAIISQRPQLEKLIATTAHEKMPWFHGKIDREDSELRLLNT
SRVNGKFLIRQRENSGRNESYALCLLHNNQVMHYRIDKDRAGKLSIPDGKKFDTLWQLVE
HYSYKPDGLLRVLTETCPRPSHHSEGSAENPYKITPNGKDDYSKQGNFLDSAMPMDTQVY
ESPYADPDELRSTKVNRSDLTLEDGELGSGNFGTVLRGVYQMKKTQKVVAVKILKNDDDN
AAVKDEMLREANVMQQLDNPYIVRMIGICEAENLMLVMELAELGPLHKFLQKNKHITVKN
LTELVHQVSMGMKYLEEHNFVHRDLAARNVLLVTQHYAKISDFGLSKALTEDENYYKAKG
HGKWPLKWYAPECMNYLKFSSKSDVWSFGVLMWEAFSYGQKPYKGMKGNEVIQMIENGQR
MSAPPDCPPEMYDLMKKCWTYKPDERPGFSVVEPRLRHYYYDISQ
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggtggataaggtgcatttgctgccgtacttcttcggcaacatcacccgcgaggagtcc
gaggtttatttgcaacagggaggatcaggagacggcctgtacctgctccgccagagccgc
agtttcctcggcggctatgccctgtcactgtcctacggccgccagttctaccactatacc
atagagagggagctgaacgacacctacgccatcgctggaggcaaatctcaccggacgcct
atagatgtgatcaactaccactctcaggagtctgacggcctcatctgcctgctgaagaag
ccctttcaccggccccgcggcacagagcctaaagtcgggccctttgaagacctgaaggag
cagctcatccggcagtatgtcgagcaaacctggaatttaaagggttcagcgctggaccag
gccatcatcagccagaggcctcagctggagaaactcatcgccacaacagcacatgagaag
atgccctggtttcacggaaagatagatcgcgaggattcagagctgcgtttgctcaatacc
tcacgggtcaacggcaaatttctaatcagacaaagagaaaacagtggcagaaacgagtcc
tatgcgctgtgtctcctgcataacaatcaagtcatgcactatcgcattgataaggacagg
gctggaaagctttccattcctgatggcaagaagttcgacacactatggcagctggtagaa
cactattcttacaagcctgacggcctgctccgcgtgctcaccgagacctgcccgagacca
tcacatcattctgagggttctgctgaaaacccttataaaatcacacctaacggcaaagac
gactattccaagcagggtaatttcttggattcagctatgccaatggacacacaggtgtat
gaaagtccatatgcagatcccgatgagctgcgatcgactaaagtgaaccgcagtgatctg
actctggaagatggagaactaggctcagggaactttggcactgtcctgagaggtgtttac
cagatgaaaaaaacacagaaggttgttgctgttaagatcctaaagaatgatgacgataat
gcagcagtaaaggacgagatgttgcgggaggcgaacgtcatgcagcagctggataatcca
tacatagtccgcatgattgggatctgtgaagcggaaaaccttatgctggttatggagctc
gctgaactggggccgcttcacaagtttctgcagaagaacaagcacatcactgtgaagaac
ctcacagagctggttcatcaggtgtcaatgggcatgaaatatctggaagagcacaacttt
gttcacagagatcttgcagccaggaatgtgcttttagtcactcagcattatgcaaaaatc
agcgactttggcctctctaaagccctgacagaggatgagaactattacaaggccaaaggt
catggtaaatggccgttgaaatggtacgcacccgagtgcatgaactacttgaaattttct
tcaaagagtgacgtgtggagctttggagtcctgatgtgggaggctttttcatacggacag
aaaccatacaagggcatgaagggaaatgaagtcatccaaatgattgagaacggacagcgg
atgtccgcaccgcccgactgcccacctgagatgtacgacctcatgaagaaatgctggaca
tacaagccagatgagagacctggattttctgtagtcgaacccagactgcggcattactat
tacgacatttctcagtga

DBGET integrated database retrieval system