KEGG   Danio rerio (zebrafish): 405841Help
Entry
405841            CDS       T01004                                 

Definition
zgc:77086 (EC:5.3.4.1)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    405841
Enzymes [BR:dre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     405841
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   405841
  Exosomal proteins of colorectal cancer cells
   405841
  Exosomal proteins of bladder cancer cells
   405841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
16
AA seq 488 aa AA seqDB search
MRLPCFIICAVLTVWLAEGSDVLELGDSDFDRSAGMHDTLLVEFFAPWCGHCQRLAPEYE
AAATKLKGTLALAKVDCTVNSETCERFGVNGYPTLKIFRNGEESGAYDGPRTADGIVSYM
KKQAGPSSVALLKEADLDGFVDNYEASVVGFFSGEDSAQLAEFLKASSALRDSYRFAHST
DVGAGLKYGVDGECVLLFRPPRLSSKFEDNVVKYTEHLSVSSLHKFVKDNILGLCPHMTM
ENRDTVRESDLLTAFFNVDYLRNPKGTNYWRNRIMKVATQFQDRGLTFAVADRQEFQDEL
EEEFGVSSSEGGDVPLVTIRTRAGQKYSMQEEFTRDGKSLEKFLEDYFAKRLKRYVKSEP
IPESNDGPVKVLVADTFDAIVNDPEKDVLVEFYAPWCGHCKNLEPKYKELGEKLSGNPNI
VIAKMDATANDVPPNYDVQGFPTIYFVPSGQKDQPRRYEGGREVNDFITYLKKEATNPLI
LDDSRDEL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttaccttgttttataatctgtgctgtgctgactgtgtggctcgcggagggcagc
gatgtgctggagctcggagattctgactttgaccggagcgcaggcatgcatgacactctg
ctagtggagttcttcgcaccttggtgtggtcattgtcaacgactcgctccagaatatgaa
gctgctgccactaagttgaaagggacgctggctctggcaaaggttgactgcaccgtgaac
tcagagacctgtgagcgctttggagtgaatggatatcccacccttaaaatcttccgaaat
ggagaggaatctggagcttatgatggtccaagaacagcagatggcattgtgagctacatg
aagaagcaagcgggtccaagttctgtggctctgctcaaagaggcagatttggatggtttt
gttgacaactatgaggccagtgtggtgggcttcttctctggggaagacagtgcacaactt
gcagagtttctgaaggcctccagtgccctgagggacagctatcgattcgctcactccact
gatgtgggagcaggcctgaaatatggggtggatggagagtgtgttctgctgtttcgccct
cctcgcttgagcagcaaatttgaggacaatgtggtgaaatacactgaacatctttccgtt
tcatcgctccataaattcgtcaaagacaacatacttggtctctgtccacatatgaccatg
gaaaaccgggacacagttagagaaagtgacctgcttacagcatttttcaatgtagattac
ttacggaatcccaaaggcacaaactactggaggaatagaataatgaaagtggctacacag
ttccaggatcggggtctgacatttgcggtggcagatcgacaggagtttcaagatgagctt
gaggaggagtttggtgtgagttcatctgaaggtggagacgttcctctcgtcaccatcagg
accagagcgggacagaaatactccatgcaggaggaattcacgcgagatggcaagtccttg
gagaagtttttggaggattactttgctaaaagattgaagcgatatgtgaagtctgagcct
attccggagtccaacgatggccctgtcaaggtcttggttgctgacacatttgatgcaatt
gtgaatgatccagagaaggatgttttggttgagttttacgctccctggtgcggccattgc
aagaatttggagcccaaatacaaggagcttggagaaaagctctctggcaacccaaacatt
gtcattgctaaaatggacgccacagctaatgatgtgcctccaaattatgatgtccaagga
tttccaacaatttattttgtgccttctggacaaaaggatcagccacgtcgatatgagggc
ggtcgcgaggttaatgacttcatcacctatctgaagaaagaagcgacaaatccactcatt
ttagacgattcaagagatgaactgtaa

DBGET integrated database retrieval system