KEGG   Danio rerio (zebrafish): 405845Help
Entry
405845            CDS       T01004                                 

Definition
zgc:77118
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dre  Danio rerio (zebrafish)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dre01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:dre00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dre04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
15
AA seq 291 aa AA seqDB search
MADGCRPCVFILVVLLLLPSAIMAYRPVIIIHGLFGGPVQMTPLVNLIKESHPGTSVTAV
SLYDYTDSVKPMWDQVEGFKKVLQPIIESTGDGVHLICYSQGGLICRGVLATLPQHNAHS
VIFLSSPLAGQYGVTRAISGVFPKLPKSSLHNVCYTELGQKTSFCSYWNDPHHREKYLNS
SVFLAPLNGEVEHVNSTEWRNNFLRIKTMVLIGGPNDGVILPWQSSMFGSFDSDGKVIDM
ENQDFYVRDTFGLKTLKSQSAVWKCIVPGVKHNFWPSDPRVFQNCIEKWLT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggctgatggctgcagaccatgtgtttttattttggttgttttactgctgctgccctca
gccatcatggcgtacagaccagtgattattattcatgggctatttggtggacctgtacag
atgacaccgttggtgaacttaattaaagagtctcatccaggtacgagtgtgactgcagta
tctctgtatgactacacggacagtgtgaagccaatgtgggatcaggtggaaggctttaaa
aaggttctccaacccatcattgagagtactggagatggtgtccatcttatctgctactcg
caaggtggtttgatatgtcgaggagttcttgctactcttcctcaacacaatgctcactct
gtgatattcctgtcttcaccactagctggccagtatggagttacaagggccatcagcggt
gtgttccctaaactgcccaagtcctcactgcacaatgtttgttatactgaacttggacaa
aaaacctccttctgcagctactggaatgatccacatcatagagagaaatacttgaattcc
agtgtctttctggccccgctgaacggagaagtggaacatgtcaactcaacagagtggcga
aacaattttctgcgcataaaaaccatggtgttgattggcggaccaaatgatggtgttatc
ttaccgtggcaatcaagtatgttcgggtcttttgacagtgatggaaaggtgattgatatg
gaaaatcaggatttttatgtaagggatacctttggcctgaaaacactgaaatcccaaagt
gccgtgtggaagtgtatcgttcctggtgttaaacacaatttctggccctcagaccccagg
gtcttccagaactgcatagaaaagtggctcacgtaa

DBGET integrated database retrieval system