KEGG   Danio rerio (zebrafish): 405892Help
Entry
405892            CDS       T01004                                 

Gene name
nlk1, nlk, nlkb, zgc:111875
Definition
nemo like kinase, type 1
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    405892 (nlk1)
   04310 Wnt signaling pathway
    405892 (nlk1)
   04068 FoxO signaling pathway
    405892 (nlk1)
 Cellular Processes
  Cell communication
   04520 Adherens junction
    405892 (nlk1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     405892 (nlk1)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   405892 (nlk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
3
AA seq 475 aa AA seqDB search
MAFHGSTRPTVCGNLFPASELGHKYFCVNTTAGTTSTGLGATPNPTGPNAPAGTPRHPAS
LGGSAGGGAAIPQPHSNPASEVPSPAEMEPDRPIGYGAFGVVWSVTDPRDGRKVALKKMP
NVFQNLVSCKRVFRELRMLCFFKHDNVLSALDILQPPQIDCFEEIYVITELMQSDLHKVI
VSPQPLTTDHIKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCLLKICDFGLARVEE
PDPSRHMTQEVVTQYYRAPEVLMGCQHYTSSIDVWSVGCIFAELLGRRILFQAQSPIQQL
DLITDLLGTPPLSAMTSACEGARAHILRGPHKPPSLSVLYMLSDGATHEAVHLLCRMLVF
DPAKRISGSDALSHPYLDEGRLRYHTCMCKCCYSVPSGRVYTRDFEPPADRPFSHNYEQS
MHSVWQGKELIHRFITEHQQGKRVPLCINPQSAAFKTFIRSTAWHSSKVSRKEER
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggctttccatggatccactcggccgacagtgtgtggtaacttgttcccagcatcagag
ttaggccacaaatatttttgtgtcaacaccacagccggcactacctcaacgggcctaggc
gcaacaccaaatccgactgggcccaacgcacctgctgggactcccagacacccggcgtct
ctcgggggcagcgctggcggaggggcggccatcccgcaacctcacagtaacccagctagt
gaggtgccaagtcctgctgaaatggagcctgatcgacctatcggttacggggcgtttgga
gtggtctggtctgtgacggaccctcgggatggacgcaaggtggctctgaagaaaatgccc
aatgtcttccagaacctggtctcctgcaaacgtgtgttcagggaactccggatgctgtgt
ttctttaaacatgacaacgtgctttctgcccttgacattctccaacctccacaaatcgac
tgctttgaggagatatacgtgatcactgagctcatgcagagtgacctacataaagtcatc
gtttcccctcagcctctcaccaccgatcacatcaaggtgttcctctaccagatactcagg
ggactgaagtacctgcactcagcaggcattctccacagagacatcaaaccagggaacctg
ctggtcaacagcaactgtctgcttaagatctgtgactttggcctggcacgtgttgaggag
ccggatccctctcgtcacatgacccaggaggtggtgacgcagtattaccgtgctccagag
gtgctgatgggatgccagcattacacttcatctatagatgtctggtctgttggttgcatc
tttgccgagctgctgggccgacggattctcttccaggctcagagtcccatacagcagttg
gatctaatcactgatctcctcgggactcctcctctttctgccatgacgtctgcatgtgaa
ggagctcgagcgcacattctcagaggaccccacaaaccaccgtcattgtctgttctgtac
atgctgtcagatggggcaacacatgaagccgttcatcttttgtgccgaatgctagttttt
gatccagccaagcgcatctccggcagtgacgctctgtctcacccgtatctggacgagggt
cgtcttcgctaccacacctgcatgtgcaagtgttgttactctgtgcccagcgggagggtt
tacacccgagactttgagcctcctgcggatcgaccgttcagccacaactatgagcagagc
atgcactccgtctggcagggcaaagagctcatccatcgttttataacagagcaccagcaa
ggcaaacgagtgcctttgtgcatcaatccccagagcgcagcctttaaaaccttcatcaga
tccacagcctggcattcatcaaaggtatcaaggaaagaggagagatga

DBGET integrated database retrieval system