KEGG   Danio rerio (zebrafish): 406357Help
Entry
406357            CDS       T01004                                 

Gene name
uchl5
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase isozyme L5
  KO
K05610  ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     406357 (uchl5)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   406357 (uchl5)
Ubiquitin system [BR:dre04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    406357 (uchl5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C12
Motif
Other DBs
NCBI-GeneID: 406357
NCBI-ProteinID: NP_998249
ZFIN: ZDB-GENE-040426-2051
Ensembl: ENSDARG00000103404
Vega: OTTDARG00000034786
UniProt: Q6NWL6
Position
22
AA seq 329 aa AA seqDB search
MAGSAGEWCLMESDPGVFTELIKGFGCKGAQVEEIWSMEPENFENLKPVHGLIFLFKWQP
GEEPAGSIVQDSRLDQIFFAKQVINNACATQAIISVLLNCTHPDMLLGETLTEFKEFSNS
FDAAMKGLALSNSEVIRQVHNGFARQQMFEFDAKSTAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGVCNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEKKIVELQA
QLTEEEPMDTDQSGNHLSSIQSEIAKYQLLIEEENQKLKRYKVENIRRKHNYLPFIMELL
KTLAEYQQLIPLVEKAKEKQSAKKIQEAK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaagcgctggggaatggtgtctcatggaaagtgacccaggagttttcacagag
ctgataaagggctttggatgcaaaggtgcacaggttgaagagatttggagcatggagcca
gaaaactttgaaaatctgaagcctgttcatggtctgattttcctcttcaagtggcaaccc
ggtgaggagccagcggggtctattgttcaagactcaaggctggatcagatcttctttgcc
aagcaggtcatcaataatgcctgtgcgacccaagcgatcatcagtgtgttgttaaattgc
acacatcctgatatgctcctcggggaaacgctgacagaattcaaagagttttcaaacagt
tttgatgcggcgatgaagggtcttgctctcagtaactctgaagtaattcgacaagttcac
aacggcttcgccagacagcagatgttcgagtttgatgctaaatcaacggctaaggaagag
gatgcttttcattttgtgagctatgttccagttaatggacgactgtatgagttggacgga
cttcgtgaaggaccaatagatttgggtgtatgtaaccaggatgactggatcagtgctgta
cggcctgtcattgagaaacgaatacagaaatacagtgagggagagattcgattcaacttg
atggccatcgtttctgaccgtaagatgatttatgaaaagaagattgttgaactgcaggct
cagctcacagaagaagagccaatggacacagatcagagtggaaatcatctgagctccatc
cagtctgagatcgccaagtatcagctcctcattgaagaggagaaccaaaaacttaaaaga
tacaaggttgagaacatcagaaggaagcacaactacctaccctttattatggagctcctg
aagactttggctgaatatcagcagctgatcccactggtggaaaaggcaaaggaaaaacaa
agtgccaagaaaatacaggaagcaaagtaa

DBGET integrated database retrieval system