KEGG   Danio rerio (zebrafish): 406385Help
Entry
406385            CDS       T01004                                 

Gene name
galcb
Definition
(RefSeq) galactocerebrosidase precursor
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00600  Sphingolipid metabolism
dre01100  Metabolic pathways
dre04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    406385 (galcb)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    406385 (galcb)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     406385 (galcb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M
Motif
Other DBs
NCBI-GeneID: 406385
NCBI-ProteinID: NP_998276
ZFIN: ZDB-GENE-040426-2115
Ensembl: ENSDARG00000016474
Vega: OTTDARG00000034992
UniProt: Q7ZUD5
Position
17
AA seq 664 aa AA seqDB search
MYIGNQCCVVLSIFLYISGCLGENYDIDDSLGLGQTFDGIGGLSGGGATSRLLVNYEEPY
RSQILDYLFKPKFGASLQILKVEIGGDAQTTDGTEPSHMHYEDDENYFRGYEWWLMVEAK
KRNPNITLIGLPWAFPGWVGNGKNWPYDFPDITASYVVAWIHGAKKYHDLDIDYIGIWNE
KSFNVKYIKLLRYLLDKRGLEKVKIIASDDLWEPITSAVFADKELYDAIEVLGVHYPGTK
TVPRALKTGKKLWSSEDYSTFNDNVGGGCWARILNQNYVNGKMTATISWNLVASYYENLP
FGRDGIMTANEPWSGNYVVESPVWTTAHTTQFTEPGWTYLQTVGHFTHGGSYVALTDQRG
NLSIITETMTHDHSVCIRPPLRPYNVTVQNVTFNLKGTFAFISQLDVWHSKFDFKTDKTV
LFQKLDPVKVIGGSFSIELDVDEIYTFTTITNGQRGTYPDPPPSAPFPKSYRDDFNVSGN
FSEAPNFADQTGVFEYFTNLTDPGPHVFTLRQVVTQRPITWAADADQTISVIGDYGWHDI
MVSCDVYMEAVQTGGVFIAARVDRGGGVIRSTRGVFFWVYADGTYKITNDLRGLAVLAKG
SAGTRARTWYTLTLRVQGNYASADLNGYSLWKNAVLLNPLHGWVAIGTSSFQLAQFDNFV
IEAE
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtacataggaaatcagtgttgtgtggttttgagcatttttctctatatcagtggttgt
ttaggggagaattacgatatagatgatagtctcggattaggacaaacgtttgatggcatt
ggtggattaagcggtggtggggcgacatcgcgtttacttgtcaattatgaggagccatat
cggagtcagatactagactacctgtttaagccaaaatttggagcctccttacaaatccta
aaggttgaaatcggaggcgatgctcagactacagatggaactgagccctcacacatgcac
tatgaagatgatgagaattattttagagggtatgaatggtggctaatggtggaagccaag
aagaggaatccaaacatcaccctcataggtctaccatgggcctttccaggttgggttgga
aatggtaaaaactggccttatgatttccctgatatcactgcctcttatgtggtggcgtgg
attcatggagctaagaagtaccatgacctggatattgactatatcgggatatggaatgaa
aagagctttaatgtgaaatacataaagcttttgcgatacttactggataaaaggggtctg
gaaaaagttaaaatcattgccagtgatgacctctgggagccaatcacctctgctgtattt
gctgacaaagaattatatgatgctattgaagtcttgggggtacattacccaggcacaaaa
actgtgcctcgtgccctgaagactggcaagaaactgtggtcctctgaagactatagtacc
ttcaatgacaatgttggcggaggttgctgggcccgaattctcaaccagaactatgtcaat
ggcaaaatgacagcgaccatatcctggaaccttgttgcaagttattatgagaaccttccc
tttggaagagatggaataatgactgcaaatgagccgtggagtggaaattatgttgttgag
tcccctgtttggacaacagcccacactacccagtttactgagcctggctggacatacctg
cagacagtaggacacttcactcatggtgggagttacgttgcactgactgatcagagagga
aatctctcaataatcactgaaactatgacccatgaccactctgtgtgtatccgacctcct
ctgcgtccctataatgtcacagtccagaatgtaacattcaatctgaaaggaacttttgct
ttcatcagccagctggatgtgtggcactcaaagtttgatttcaagacagataagacggtc
ctcttccaaaaacttgaccctgttaaagtaataggtgggtctttcagcatagagcttgat
gtcgatgaaatatatacatttactactataaccaatggtcagagagggacttaccctgat
cctccaccctctgctccatttcctaaatcatacagagatgattttaatgtctctggaaat
ttctcagaagctccgaactttgcagatcagacaggggtttttgaatacttcactaacctt
acagatcctggacctcatgtttttactctgcgtcaggtggtcactcagcgtcccatcaca
tgggctgcagatgctgatcagacaataagtgtcattggtgattatgggtggcatgacata
atggtgtcgtgtgacgtctacatggaggctgtccagaccggtggagtattcattgccgct
cgagtggacagaggtggaggtgtcatccgaagtacaagaggagtctttttctgggtgtat
gctgatggcacctacaaaatcaccaatgatctccgtggattggcggtccttgccaaaggt
tcggctggaactagagcacgtacatggtacacattgacccttagagtccagggaaactat
gcctcagcagatctcaatggctattctctgtggaagaatgcagtgctcttgaaccctctg
catggatgggtggccataggcactagttcttttcaacttgcacagtttgataattttgtc
atagaggcagaataa

DBGET integrated database retrieval system