KEGG   Danio rerio (zebrafish): 406470Help
Entry
406470            CDS       T01004                                 

Gene name
pla2g7, zgc:77563
Definition
phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma) (EC:3.1.1.4)
Orthology
K01062  
platelet-activating factor acetylhydrolase [EC:3.1.1.47]
Organism
dre  Danio rerio (zebrafish)
Pathway
Ether lipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00565 Ether lipid metabolism
    406470 (pla2g7)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     406470 (pla2g7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 404 aa AA seqDB search
MGNSSGHNNTMTIPPGKGPHQVGCTDLMVGHTVQGTFMRIYYPCQATEHPHLPDWVPCRE
YFNGLADFMKINRALSERIFNYLFGSCKIPAAWNASFKPDGKYPVIIFSHGLGAFRTLYS
AICVELASQGFIVAAVEHRDESSSATFYFKENAEPGTKRHMSSDISKPVSDNLEEVWMYY
RPLKTGENEFPLRNKQVKQRADECIRALDILFDIHSGKSVENVLQSNFDLSTMENSMDLC
RIAVMGHSFGGATVIECLCKEVRFKCGVALDTWMFPLDEEIFPGVKQPIFFINSEKFQWI
GNIIRMKKLDSAIFPRKMITIKGTVHQSFPDFTFLTGNWIGRLMKLKGEIDPHIALDLCN
KATLAFLQRHLSLNRDFNQWDPLIEGKDDNLIPGTNITIPHSSI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggggaactcaagcggacacaacaacactatgactatcccaccaggaaaaggaccccat
caagtgggatgcacagacctgatggtgggccacacagtccagggtacgttcatgagaatc
tactatccgtgccaagcaaccgagcatcctcatctgcctgattgggtcccgtgtagggag
tattttaatggccttgcagacttcatgaagattaacagagcactgagtgaacgtattttc
aactacctctttgggtcatgtaaaatcccagcagcctggaatgcgtcatttaaaccggat
gggaaatatcctgttataattttttcccatggactgggcgctttcaggacattgtattct
gccatatgtgttgaactggcctcacagggcttcattgttgctgcggtggagcacagggat
gaatcttcgtctgcaacattttatttcaaagaaaatgctgagccaggaacaaaaagacat
atgtcatctgacatctctaaacctgtgtctgataatcttgaagaggtttggatgtactac
agaccattgaagacgggcgagaatgagtttcccctgagaaacaaacaagtaaagcagaga
gcagatgaatgcatcagagctttggatattctctttgacatccattcaggaaagtctgtg
gaaaacgtcttgcagtccaactttgatctgtcaacaatggagaattccatggatttgtgt
agaatagcggttatgggacattctttcggaggcgcgacagtgattgaatgtttgtgcaag
gaagtccgattcaagtgtggtgtggcactggacacctggatgtttcccttggacgaggag
atcttccctggagtgaagcagccaatcttttttattaactctgaaaaatttcagtggatt
ggcaatatcattcgcatgaagaagttggactctgctatctttcccagaaaaatgattacc
atcaaaggcacagtccatcagagctttccagacttcacatttcttaccggaaactggatt
ggacggctcatgaagctgaaaggagagattgatccacacattgccttggatctttgtaac
aaagcaactttggcttttcttcagaggcacttgtctctaaacagagacttcaatcagtgg
gatcctttaattgaaggaaaagatgacaacttgattccaggaaccaatattactatacca
cattcatctatttaa

DBGET integrated database retrieval system