KEGG   Danio rerio (zebrafish): 406508Help
Entry
406508            CDS       T01004                                 

Gene name
usp33, zgc:77308
Definition
ubiquitin specific peptidase 33 (EC:3.4.19.12)
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
2
AA seq 897 aa AA seqDB search
MSGVSSNDCPHLECVGEITKEELIQKSHGQCQDCKVGGPNLWACLENGCSYVGCGESHAD
HSTVHSQETRHNLTVNLTTLRVWCYACTKEVFLERKLGPHKQLPNAAKAVSPVQTPCQDL
NTPGSPTSLRVPSAGTCDDLDMETEEEDELRTRGLTGLKNIGNTCYMNAALQALSNCPPL
TQFFLECGGLVKTDKKPALCKSYQKLVTDLWHKNRNSYVVPTNLFQGIKAVNPMFRGYSQ
QDSQEFLRCLMDQLHEELKELIPEPEDPNQAVAMDDSPDEDNHSQSDDFQSCESCGSSDR
ADNEGPRVPEDINEAEMLMPEQNQNNRDWQKEKNLINNLYRAGSHGDLDKDVDTTSDSRP
IISSQGAIKAQGRTSDSEIQVSSTVRPQSPTGNEGITSRLSSSPPKSSAWPNLSSTHKKV
PMFTPTKTKRQRKYHSIISEVFDGTIVSSVQCLTCDRVSVTLENFQDISLPIPGKEDLAK
LHSSSHQTALVKAGSCGEAYAPQGWIAFVMEYIKSWFWGPVVTLQDCLAAFFARDELKGD
NMYSCEKCKKLRNGVKFCKVQSLPEILCIHLKRFRHELMFSTKIGTHVSFPLEGLEMQPF
LAKDSSALTTTYDLLSVICHHGTASSGHYIAYCRNELNQLWYEFDDQSVTEVSESCVQNA
EAYVLFYKKSNDETQKERRKVTSLFNMMEPSLLQFYVSRQWLNKFKTFAEPGPISNHDFL
CAHGGIPPNKATYIDDLVLMIPQNVWDHLYSRYGGGPAVNHLYVCHTCQNEIEKLEKRRK
NELDMFVRLNKAFQEEESPVVIYCISMQWFREWESFVKGKDIDPPGPIDNSKIAVNKNGH
ITLKPGADSGQISEETWNFLHNIHGGGPVVTVRPSVSHQESETSQSEEKIEVETRTV
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgtctggagtgtccagcaatgactgtccacacttggagtgtgtgggggagatcaccaaa
gaagaactcatccagaagtctcatggtcagtgtcaggactgcaaagttgggggaccaaat
ctttgggcatgtctagagaatggctgttcatatgttggctgtggagaatcgcatgcggat
cacagcactgttcactctcaggagacgcggcacaacttgacggtcaatctgaccactttg
agagtgtggtgttatgcctgcaccaaggaggttttcctggaaaggaaactgggtccacat
aaacagttgcccaatgctgccaaagcagtatccccagtgcagactccctgccaggacctc
aatactcctgggagtcctacttccctaagagttccttcagcaggaacatgtgatgacctg
gacatggagacagaggaagaagatgaactgaggactagaggtctgactggactaaagaac
attggcaatacgtgctacatgaatgcagctttgcaggcactctccaattgtcctccgctg
acccagttctttttggagtgcggtggtctggtgaagacagacaagaagccagcgctatgc
aagagctatcagaaactcgtcacagacctgtggcacaaaaacaggaactcctatgttgtt
cccacaaatctattccagggcattaaggctgtgaacccaatgtttcgtggttactcccaa
caggactctcaggaattcctgcgttgtttgatggaccaactccacgaggagctcaaggag
ctcattcctgaacccgaggacccaaatcaggctgtggccatggacgacagtcccgacgag
gacaaccacagccaatcagatgacttccagtcctgcgagtcttgcggcagcagtgatcgt
gctgataacgaaggccccagagtcccagaagacatcaacgaagctgagatgctgatgcct
gaacagaatcaaaacaaccgagattggcagaaagagaagaatctcatcaacaacctgtac
cgtgccggttcccatggcgacctggataaagacgtggacacgaccagtgattcaaggcca
atcatcagcagccaaggagcaatcaaagctcaggggcgaacttcagattctgaaatccag
gtcagcagtactgtcagaccgcagagtcccactggaaatgagggcatcacatctagactg
tccagcagccccccaaaatcctcagcatggccaaacctgagctctactcacaagaaagta
cccatgttcaccccaacaaagaccaagcggcagaggaaataccacagcatcatttctgaa
gtgtttgatggcacaattgtcagctcagttcagtgcctaacctgtgatagggtttcggtg
actttggagaacttccaggacatctctctgcccatcccagggaaagaggaccttgccaag
ctgcactcgtcctcccaccagacggctctggtcaaggctggctcttgtggtgaagcatac
gcccctcaaggctggattgcttttgtcatggaatatatcaagagctggttctggggacct
gtggtgacactgcaggattgtctggcagccttttttgccagggatgaactaaaaggagac
aacatgtacagctgtgaaaaatgcaagaaattacggaatggggtcaaattctgcaaagtt
cagagtttgccagagattttgtgcattcatctcaagcgcttcagacatgaactgatgttc
tccaccaaaatcggcactcatgtgtcattccctctggaaggccttgaaatgcagcccttt
ttggccaaggacagctctgccctgaccaccacctatgacctgctttcagtcatctgtcac
catggcactgccagcagtggccactatattgcctattgtcggaatgagctgaaccaactg
tggtacgagtttgacgaccagagcgttactgaagtgtcagagtcctgtgttcaaaacgct
gaggcatatgtgctcttttacaagaagagtaatgatgagactcagaaggaaaggaggaag
gtgaccagtctgttcaacatgatggagccaagcctcctgcagttctacgtctcccgccag
tggctgaacaagttcaaaacttttgctgagccaggacccatttccaaccatgacttcctg
tgtgcccatggaggtattccgccaaataaggccacatacattgatgaccttgttttgatg
attccccaaaacgtgtgggaccatctctatagcaggtatggaggcggacctgccgttaat
cacttgtatgtctgccacacctgccagaatgagattgagaagctggagaaacgacgcaag
aatgaactggacatgtttgttcggctcaataaggcgtttcaggaggaggagtctcctgtg
gtgatatactgtatcagcatgcagtggttccgggaatgggaaagctttgtcaaaggcaag
gacattgacccaccggggccaattgataactccaagattgctgtaaataaaaatggacac
atcacattgaagccaggtgctgattcaggtcaaatatccgaagagacctggaacttcctc
cataacattcacggaggagggcctgtagtgaccgtgcggcccagcgtcagccatcaagag
tccgagacttcacagtcagaggagaagatcgaagtggagacgcgcacagtgtag

DBGET integrated database retrieval system