KEGG   Danio rerio (zebrafish): 406598Help
Entry
406598            CDS       T01004                                 

Gene name
pik3cg, wu:fb15d07, zgc:77033
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
dre  Danio rerio (zebrafish)
Pathway
Inositol phosphate metabolism
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    406598 (pik3cg)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    406598 (pik3cg)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    406598 (pik3cg)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     406598 (pik3cg)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    406598 (pik3cg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
4
AA seq 1098 aa AA seqDB search
MEQQASDDEPPVVRREENKRRRRRMKAFTSASAVSMEHIAVEFVLPTTNKNSKTLDTLQL
DVTGNWTVEQVKVQLWHRAVTSKLCPEFYQKYSPDYCILLYQKKGNWYEIYDKQQVFQTL
DCIRYWKALRKDVGKIHLVVRQQPAEDSLQYQRFLNHLIGYDVTDVSNVHDDELEFTRRK
LLTPRKIELSDRDPNLYSMDPWMTTTPMPEYLLSKISNNHILMVIHKETTSQTIKVSIDD
TPVQVLQSFFAKITNKRALLGISEDVSESDFVLRVCGREEYLYGNNAIKDFHWIRQCLKN
GEEIHLVLEHPPNPEQDVVQKEDWSQVDDCTGVAGTHEQLTITEKDHEKVFTISLWDCNR
KFRVKILGIDIPVLPRNSELIVFVEASIFHGQQLLAQERTSSKPFTEEVIWNTWLEFNIK
IKDLPKGARLSLQVSCGKAQTQTSKETECKNKSRLLYYVNLLLVDHRSLLRQGEFILHMW
KMPEKSEDNSSVNADKLTSATNPDKNNSMAVAILLDKYCYPVALPKSKDSPDIEGERGQR
EMPNHLRKQFEQIIATDPLHPLTSEDKELLWHFRQECMRDPKAYPKFLSSVKWGKQEAVA
ITHHLLERSTIWDRSVLDVGLVLQLLDCHFSDENVRTIAVRKLETLGDDDVLRYLLQLVQ
AVKFEPYHDSALARFLLKRALRSKRIGHFLFWFLRSEIAQSMHYQQRYAVILEAYLRGCG
EEMLQDFRKQVEITEALQKVAREIKQISAEKYDISAQVVFQLRQKLEGLQVLGLPDSFKV
PYDPGLRAGALVIEQCKVMASKKKPLWLQFKRADPTTLSSDTIGIIFKDGDDLRQDMLIL
QILLIMESIWELESLDLSLLPYGCISTGNKIGMIEIVKDATTIANIQQSTVGNTGAFKDE
ILSQWLREKCVNEDKHQQAVDRFVFSCGGYCVATYVLGIGDRHNDNIMITETGNLFHIDF
GHILGNYKSFLGISKERVPFVLTPDFLYLMGTTGKKSSPNFLQFQNVCLKAYLALRHHTN
LLIILFSMMLMTGMPQLTSKEDIEYIREALTVGRSEDEAKQHFLDQIEICRDKGWTVQFN
WFLHLVLGIKQGVEKRSA
NT seq 3297 nt NT seq  +upstreamnt  +downstreamnt
atggaacagcaagccagtgatgatgaaccaccagtagttcgcagagaggaaaacaagagg
agaaggagaaggatgaaagcatttacatctgcctcggctgtctcgatggaacatatagct
gttgagtttgtacttcctaccaccaataaaaatagcaaaactttagacacattgcaacta
gacgtgactggaaattggacggtagagcaggtgaaggttcagctttggcacagagcggta
acctctaagttatgccctgaattttaccaaaaatactctccagactactgcatcctgctt
tatcagaagaaaggcaactggtatgaaatctatgacaaacagcaggtattccaaaccctt
gactgcattagatattggaaagcgttgaggaaagatgtagggaaaatccatctggttgtt
cggcaacaacctgctgaggattcgcttcagtaccaacgatttctcaaccatctaattgga
tatgatgtcaccgatgtcagcaacgtccatgacgatgaactggagtttacacgaagaaag
ctactgacccctcggaaaattgagctatctgatcgggatcccaacctttattcgatggat
ccctggatgaccacaacacccatgcctgaatacttgctcagcaaaataagcaacaatcat
atccttatggtgatacacaaagagacaacaagccagactattaaggtgtctatagatgat
acaccagtccaggtacttcaaagcttcttcgccaagattactaacaagagagcactttta
ggcatatcggaagacgtcagtgaatcagattttgtcttgagggtttgcggaagagaggaa
tacctatatggcaacaacgcaattaaagatttccactggatcagacagtgtcttaaaaac
ggtgaagagattcatctagttttagagcaccccccaaacccagaacaagatgtggttcaa
aaagaggactggtctcaggtcgatgactgcactggtgtcgctggtactcacgaacaactc
accataactgagaaagaccatgaaaaggtgttcaccatctccctttgggactgcaatcgt
aaattcagggtgaagatcttgggtattgacatcccagtactcccgcgtaattcagaattg
atcgtgtttgtagaggccagtattttccatggacaacaactgctggctcaagaaaggaca
agctcaaaaccattcacagaagaggtgatttggaacacctggttggagtttaatataaag
atcaaggacttacccaaaggtgcccgacttagcctgcaagtgtcgtgtggaaaggcacag
acacaaacatctaaggaaactgaatgtaaaaacaagtctcgcttactctactatgtcaac
ttgttattagttgatcaccgctccctacttagacaaggtgagttcatcttgcacatgtgg
aagatgcctgagaagagtgaagacaacagcagtgtaaatgcagataagcttacatccgca
accaacccagacaagaacaactcaatggctgttgctattctcctggacaagtactgctac
cctgtggctcttcccaagagcaaagattctcctgatattgaaggtgaaagagggcagaga
gagatgcccaaccatctacgcaaacaatttgagcagattattgctacagaccctttgcac
ccgctcacctccgaagataaagagttgctctggcacttcaggcaggagtgcatgagggat
ccgaaagcatatccgaagtttctttcctccgttaagtggggcaaacaagaggctgtggcc
ataacgcatcatcttctggaaaggagcaccatatgggaccgaagcgtgcttgatgtgggt
ttggtcttacaattactggactgccacttctctgatgaaaacgtgcgcactatagctgtc
cggaagttggagactttgggagatgatgatgtcctgcggtatcttctgcaacttgtccag
gctgtaaaatttgaaccataccatgacagcgcacttgcaaggttccttctgaaacgtgca
ctcagaagcaagcggatcggccatttcttgttttggtttttaagaagtgaaattgcccaa
tccatgcactatcagcagaggtatgctgtaatactggaagcgtatctccgtggctgtggt
gaagaaatgctacaggacttcaggaagcaggtggagatcacagaggccttgcaaaaggtc
gctcgtgagattaagcaaatatctgctgagaagtatgacatatcagcacaagttgttttt
cagctgcgccagaaactggaaggtctgcaagtcttagggttgccagacagctttaaagtg
ccttacgatccaggcctacgagcaggggcacttgtgattgaacaatgcaaagttatggca
tccaagaagaaacccttgtggctgcagttcaaacgggccgatcccaccaccttgtcgagc
gacacaattgggataatctttaaagatggggatgaccttcgtcaggacatgctgatatta
cagattctacttattatggagtctatctgggagctggagtcattggatctttccttgtta
ccttacggctgcatttccactggaaataaaattggaatgattgaaatagtgaaggatgcc
actaccattgcaaacattcagcaaagcactgttgggaacaccggagcttttaaagatgaa
atcctcagccagtggcttcgagaaaagtgtgtcaatgaggacaagcatcaacaggctgta
gatcgctttgtgttctcgtgtggcgggtattgtgtggcgacttatgtccttggcattggt
gatcgtcacaatgacaacataatgatcactgagacaggtaatctcttccacattgatttc
ggacacatacttggcaactacaagagtttcttgggaataagcaaggagcgagttcccttt
gtgctgactccagatttcctctacctgatgggcacaacaggaaagaaaagcagccctaat
ttcctccagtttcagaatgtctgtctgaaggcctacctggcgctgagacaccacaccaac
ctgctgatcatcctgttctccatgatgctgatgaccgggatgcctcaactcaccagcaaa
gaggacatcgagtacattcgggaggcgctgacagtaggacgctcagaggacgaggccaaa
cagcacttcttggaccaaattgagatctgtcgggacaagggttggacggtgcagtttaac
tggttcctacatttggtgctcggcattaaacagggtgtggagaaacggtcagcttga

DBGET integrated database retrieval system