KEGG   Danio rerio (zebrafish): 406673Help
Entry
406673            CDS       T01004                                 

Gene name
p4hb, psmb3, zgc:92596
Definition
procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), beta polypeptide (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dre04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
6
AA seq 509 aa AA seqDB search
MLKFLIVCALAAMSAAEIAEEEDVLVLKKSNFEEALKAHPNVLVEFYAPWCGHCKALAPE
YSKAAGMLKAEGSDIRLAKVDATEESELAQEFGVRGYPTIKFFKGGEKGNPKEYSAGRQA
EDIVSWLKKRTGPAATTLNDVMQAESIIADNEVAVIGFFKDVESEDSKAFIKTAEAVDDI
PFGITSDDSVFAKFEVAKDSVVLFKKFDEGRNTFDGEVSKESLLNFIKANQLPLVIEFTE
QTAPKIFGGDIKSHILMFVPKAAKDFQDKMDQFKKAAEGFKGKILFIFIDSDVDDNQRIL
EFFGLKKEECPVIRLITLEEEMTKYKPESSEITAENIISFCTSFVEGTLKPHLMSQDIPE
DWDKNPVKVLVGKNFEEVAFNPANNVFVEFYAPWCGHCKQLAPIWDQLGEKFKDNANIVV
AKMDSTANEIEAVKVHSFPTLKFFPAGDERKVIDYNGERTLDGFTKFLESGGKEGGAPVG
DEEDEEADDLDLDDAEEDDSDVEEGHDEL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaatttttgattgtgtgcgcactggccgctatgagcgcggctgaaattgccgag
gaagaagacgtactcgtattaaagaaaagtaacttcgaggaggcactgaaagctcaccca
aatgtccttgttgagttttatgcaccatggtgcggacactgcaaggccttggcccctgaa
tattccaaagcagctggaatgctaaaagctgaaggctcagatatcagactagctaaggta
gatgctacagaagaatcagaacttgctcaggagtttggtgttcgtgggtatcccaccatc
aagttcttcaagggaggagagaaagggaaccctaaggagtattctgctggtcgacaggct
gaggacatcgtcagctggctgaaaaaacgaactggacccgcagccactactttaaatgat
gtcatgcaagcagagtcaattattgctgataacgaggttgcagtaattggattttttaag
gatgttgaatcagaagattctaaggccttcattaaaaccgcagaggctgtggatgacatc
ccctttggaatcacttctgatgattcagtctttgcaaagtttgaagttgccaaggatagt
gttgtgctttttaagaagtttgatgagggtcgaaatactttcgatggagaggtcagcaaa
gaaagtttactgaacttcatcaaggccaaccagcttcccctggtcatcgagttcacagag
cagactgctcccaaaatctttggaggtgacatcaagtcccatatcctaatgtttgtgcct
aaagcagccaaagacttccaggataagatggaccaatttaagaaggcagcagagggtttt
aaaggcaaaattctcttcatcttcattgacagtgatgtggatgataatcagagaatttta
gagttctttggccttaagaaggaagaatgcccggtcatccgccttatcacccttgaggaa
gaaatgaccaaatacaaaccagaatcttctgaaataacagcagagaacataatcagcttc
tgcacatccttcgtagaagggacattaaagcctcatctgatgagtcaggacattcctgaa
gactgggataaaaatcctgtcaaggtcttggtgggaaaaaactttgaagaggttgccttc
aatcctgctaataatgtctttgtagagttttatgccccatggtgtggtcattgtaagcaa
ttagcccctatctgggatcagttgggtgagaaatttaaagacaatgcaaacattgttgtg
gccaagatggattccacagctaacgaaattgaagctgtcaaagtgcatagcttccccaca
ctcaaattcttccctgctggtgatgaacgtaaggtaattgactacaatggtgagagaaca
ctagatggtttcacaaaatttttggagagtggaggaaaagaaggtggggcaccagttgga
gatgaagaggatgaggaagcagatgatttggatcttgatgatgcagaggaagatgattca
gatgtggaagagggacatgatgagttgtaa

DBGET integrated database retrieval system