KEGG   Danio rerio (zebrafish): 406673Help
Entry
406673            CDS       T01004                                 

Gene name
p4hb, psmb3, zgc:92596
Definition
prolyl 4-hydroxylase, beta polypeptide (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    406673 (p4hb)
Enzymes [BR:dre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     406673 (p4hb)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   406673 (p4hb)
  Exosomal proteins of colorectal cancer cells
   406673 (p4hb)
  Exosomal proteins of bladder cancer cells
   406673 (p4hb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
6
AA seq 509 aa AA seqDB search
MLKFLIVCALAAMSAAEIAEEEDVLVLKKSNFEEALKAHPNVLVEFYAPWCGHCKALAPE
YSKAAGMLKAEGSDIRLAKVDATEESELAQEFGVRGYPTIKFFKGGEKGNPKEYSAGRQA
EDIVSWLKKRTGPAATTLNDVMQAESIIADNEVAVIGFFKDVESEDSKAFIKTAEAVDDI
PFGITSDDSVFAKFEVAKDSVVLFKKFDEGRNTFDGEVSKESLLNFIKANQLPLVIEFTE
QTAPKIFGGDIKSHILMFVPKAAKDFQDKMDQFKKAAEGFKGKILFIFIDSDVDDNQRIL
EFFGLKKEECPVIRLITLEEEMTKYKPESSEITAENIISFCTSFVEGTLKPHLMSQDIPE
DWDKNPVKVLVGKNFEEVAFNPANNVFVEFYAPWCGHCKQLAPIWDQLGEKFKDNANIVV
AKMDSTANEIEAVKVHSFPTLKFFPAGDERKVIDYNGERTLDGFTKFLESGGKEGGAPVG
DEEDEEADDLDLDDAEEDDSDVEEGHDEL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaatttttgattgtgtgcgcactggccgctatgagcgcggctgaaattgccgag
gaagaagacgtactcgtattaaagaaaagtaacttcgaggaggcactgaaagctcaccca
aatgtccttgttgagttttatgcaccatggtgcggacactgcaaggccttggcccctgaa
tattccaaagcagctggaatgctaaaagctgaaggctcagatatcagactagctaaggta
gatgctacagaagaatcagaacttgctcaggagtttggtgttcgtgggtatcccaccatc
aagttcttcaagggaggagagaaagggaaccctaaggagtattctgctggtcgacaggct
gaggacatcgtcagctggctgaaaaaacgaactggacccgcagccactactttaaatgat
gtcatgcaagcagagtcaattattgctgataacgaggttgcagtaattggattttttaag
gatgttgaatcagaagattctaaggccttcattaaaaccgcagaggctgtggatgacatc
ccctttggaatcacttctgatgattcagtctttgcaaagtttgaagttgccaaggatagt
gttgtgctttttaagaagtttgatgagggtcgaaatactttcgatggagaggtcagcaaa
gaaagtttactgaacttcatcaaggccaaccagcttcccctggtcatcgagttcacagag
cagactgctcccaaaatctttggaggtgacatcaagtcccatatcctaatgtttgtgcct
aaagcagccaaagacttccaggataagatggaccaatttaagaaggcagcagagggtttt
aaaggcaaaattctcttcatcttcattgacagtgatgtggatgataatcagagaatttta
gagttctttggccttaagaaggaagaatgcccggtcatccgccttatcacccttgaggaa
gaaatgaccaaatacaaaccagaatcttctgaaataacagcagagaacataatcagcttc
tgcacatccttcgtagaagggacattaaagcctcatctgatgagtcaggacattcctgaa
gactgggataaaaatcctgtcaaggtcttggtgggaaaaaactttgaagaggttgccttc
aatcctgctaataatgtctttgtagagttttatgccccatggtgtggtcattgtaagcaa
ttagcccctatctgggatcagttgggtgagaaatttaaagacaatgcaaacattgttgtg
gccaagatggattccacagctaacgaaattgaagctgtcaaagtgcatagcttccccaca
ctcaaattcttccctgctggtgatgaacgtaaggtaattgactacaatggtgagagaaca
ctagatggtttcacaaaatttttggagagtggaggaaaagaaggtggggcaccagttgga
gatgaagaggatgaggaagcagatgatttggatcttgatgatgcagaggaagatgattca
gatgtggaagagggacatgatgagttgtaa

DBGET integrated database retrieval system