KEGG   Danio rerio (zebrafish): 406728Help
Entry
406728            CDS       T01004                                 

Gene name
map2k1, si:ch211-242m18.2, wu:fj56a12, wu:fj61b01, zgc:56557
Definition
mitogen-activated protein kinase kinase 1 (EC:2.7.12.2)
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Oocyte meiosis
Vascular smooth muscle contraction
Dorso-ventral axis formation
VEGF signaling pathway
Focal adhesion
Gap junction
Toll-like receptor signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    406728 (map2k1)
   04012 ErbB signaling pathway
    406728 (map2k1)
   04370 VEGF signaling pathway
    406728 (map2k1)
   04068 FoxO signaling pathway
    406728 (map2k1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    406728 (map2k1)
  Cell growth and death
   04114 Oocyte meiosis
    406728 (map2k1)
  Cellular commiunity
   04510 Focal adhesion
    406728 (map2k1)
   04540 Gap junction
    406728 (map2k1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    406728 (map2k1)
  Endocrine system
   04910 Insulin signaling pathway
    406728 (map2k1)
   04912 GnRH signaling pathway
    406728 (map2k1)
   04914 Progesterone-mediated oocyte maturation
    406728 (map2k1)
   04916 Melanogenesis
    406728 (map2k1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    406728 (map2k1)
  Development
   04320 Dorso-ventral axis formation
    406728 (map2k1)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     406728 (map2k1)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   406728 (map2k1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
18
AA seq 395 aa AA seqDB search
MQKRRKPEPIQLNPIPDGNAINGTGATETNLEALQKKLEELELDEQQKKRLEAFLTQKQK
VGELKDDDFEKISELGAGNGGVVFKVLHRPSGFIMARKLIHLEIKPAIRNQIIRELQVLH
ECNSPYIVGFYGAFYSDGEISICMENMDGGSLDQCLKKAGKIPEQILGKVSIAVIKGLSY
LREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTH
YSVQPDIWSMGLSLVEMAIGRFPIPPPDAKELEQIFGQPLEGDPSASDTSPKPRPPGRPG
SSYGPDSRPPMAIFELLDYIVNEPPPKLPSIFGAEFQDFVNKCLIKNPAERADLKQLMVH
SFIKDSEAEEVDFAGWLCSTIGLNQPATPTHSVGM
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaaggaggaagccagagccgatccaactgaacccaattccagatgggaacgct
atcaacggcaccggggccacagaaacaaatctggaagctctgcagaagaagctggaggaa
ctggagctggacgagcagcagaaaaaacgcctggaagctttcctcacccaaaagcagaag
gtcggagagttaaaagacgatgacttcgagaagatcagcgagttgggagcaggcaatgga
ggagttgtgtttaaagtcttacacaggccgtcaggcttcatcatggccaggaagttgatc
caccttgagattaagccagcaataaggaatcagatcatcagagagctgcaggtgctgcat
gaatgtaactctccctacatcgtgggcttctatggggctttctacagcgacggagagatc
agcatctgtatggagaacatggatggcggctctttggaccagtgccttaagaaagcaggc
aagatcccagaacaaatactgggcaaagttagcattgcggtgattaaaggtctgtcatac
ctgcgggagaaacacaagatcatgcacagagatgtaaagccatctaacatcttggtcaac
tcgcgtggggagatcaagttgtgtgactttggtgtgagtggacaactcattgactccatg
gccaattccttcgtgggaaccaggtcctacatgtctcccgaacgccttcaaggcactcac
tactctgtccagcctgacatatggagcatgggtctctctctggtggagatggccatcgga
cgcttcccgatcccaccacctgatgccaaagagctggaacaaatcttcggtcagcccctg
gagggagacccatcagccagtgacacttctccaaaacccaggccccctggtcgacctggc
agctcatacggtccagacagcagacctcccatggctatatttgagctacttgattatatt
gtcaatgaaccacctccaaagctaccaagtatctttggtgcagaatttcaagactttgta
aacaaatgtttaatcaaaaatccagcagaaagagcagacctcaagcagctgatggttcat
tcgtttatcaaggactcagaggctgaggaggttgacttcgctggatggttgtgcagcacc
attggactgaaccagccagcaactccgactcacagtgtgggaatgtga

DBGET integrated database retrieval system