KEGG   Danio rerio (zebrafish): 406731Help
Entry
406731            CDS       T01004                                 

Gene name
ugt1ab, Ugt1a3, zgc:123097, zgc:66393
Definition
UDP glucuronosyltransferase 1 family a, b
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    406731 (ugt1ab)
   00053 Ascorbate and aldarate metabolism
    406731 (ugt1ab)
   00500 Starch and sucrose metabolism
    406731 (ugt1ab)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    406731 (ugt1ab)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    406731 (ugt1ab)
   00860 Porphyrin and chlorophyll metabolism
    406731 (ugt1ab)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    406731 (ugt1ab)
   00982 Drug metabolism - cytochrome P450
    406731 (ugt1ab)
   00983 Drug metabolism - other enzymes
    406731 (ugt1ab)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     406731 (ugt1ab)
Glycosyltransferases [BR:dre01003]
 Others
  Hydrophobic molecule
   406731 (ugt1ab)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
9
AA seq 536 aa AA seqDB search
MPLCSTSFGGMKRTLFVPALGLFAFLCLFSSESVQAGKVLVMPVDGSHWLSMKILVEEMS
SRGHEMVVLVPETSILIGKSGNFTTKSFRVPYSFDELNAHVDHIRKTAIEKAPRFIDIVG
ALGNLIQFTNMQVKACEGLLYDEPLMKSLRDMKFDALLTDPFLPCGSVIADYFSIPAVYF
LRGIPCRLDEAAAQCPSPPSFIPRFFTGYTDKMTFPQRMINTFMTVFEKYLCHQLFASFD
ELATRYLKKDTSYAELLGHGAVWLLRYDFSFEYPKPQMPNMVQIGGINCAKRAPLTKELE
EFVNGSGEHGFVVFTLGSMVSQLPEAKAREFFEAFRQIPQRVLWRYTGPVPENAPKNVKL
MKWLPQNDLLGHPKVRAFVTHGGSHGIYEGICNGVPMVMLPLFGDQGDNAQRLVSRGVAE
SLTIYDVTSEKLLVALKKVINDKSYKEKMMKLSAIHRDRPIEPLDLAVFWTEFVMRHKGA
EHLRPAAHDLNWIQYHSLDVIGFLLLILLTVIFVTVKSCMFCFRKCFKKSQKKKKA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgcctctctgctccacaagttttggagggatgaagagaacactgtttgttcctgcactt
gggcttttcgccttcctgtgcttgttttcctctgagtctgtgcaagctggcaaggtgctt
gtcatgccagtggatggcagccattggttgagcatgaagatcctggtggaagagatgtct
agtaggggtcatgagatggtggtcctggtccctgaaactagtattctgattgggaagtct
gggaatttcaccaccaagtctttccgtgttccctactcctttgatgaactgaatgctcac
gtggaccacataagaaagacagcaattgagaaagctccaagattcattgatatcgtgggt
gctttgggaaatctgatccagttcactaatatgcaggtgaaagcctgtgaaggactgctg
tatgacgagcccctgatgaaaagtcttcgagacatgaaatttgacgctttgctcactgat
ccattcctgccctgtggctctgtcattgctgattacttctctattcctgctgtttacttc
ttacgtggaattccttgtcgtcttgatgaagcagctgctcagtgtccttcaccgccatca
tttattcctcgcttctttactggttacacagacaagatgactttcccccagagaatgata
aacactttcatgacagttttcgaaaagtacctatgccaccaactttttgccagctttgat
gaacttgccactagatatttgaagaaggacacctcatacgcagagctgttaggtcacggt
gcagtttggcttttaaggtacgacttcagctttgaataccctaaaccccaaatgccaaac
atggttcaaattgggggcatcaactgtgcaaagagggctccactaaccaaggaactggag
gagtttgtgaacggctctggagagcacgggtttgttgtcttcactctgggctccatggtg
tcacagctacccgaagccaaagccagagagttctttgaggcatttagacagatacctcag
agagtgttgtggagatacactggaccagtcccagaaaatgcaccaaagaatgtcaaatta
atgaaatggctgccacagaatgacctcttgggccatcctaaggttagggcttttgttaca
catggtggatcacatggaatctatgaaggaatctgtaatggagtgcctatggtgatgctt
cctctgtttggagaccaaggggataatgctcagcgtttggtgtctcgaggagtcgcagaa
agcctgactatctatgatgtgacctccgaaaaactgctggttgcattgaagaaagtcatc
aatgataaaagctacaaggagaagatgatgaagctctctgccattcatagagaccgtcca
attgaaccactggacctggctgtgttctggactgagtttgtcatgagacacaaaggagca
gagcatctcagacctgcagcccatgacctgaactggattcagtatcactctctggacgtc
atcggcttccttcttcttattctattgactgttatttttgtgactgtcaaaagctgcatg
ttctgtttcagaaagtgcttcaagaaatctcagaagaagaagaaggcataa

DBGET integrated database retrieval system