KEGG   Danio rerio (zebrafish): 406731Help
Entry
406731            CDS       T01004                                 

Gene name
ugt1ab
Definition
(RefSeq) UDP glucuronosyltransferase 1 family polypeptide a3 precursor
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00040  Pentose and glucuronate interconversions
dre00053  Ascorbate and aldarate metabolism
dre00140  Steroid hormone biosynthesis
dre00830  Retinol metabolism
dre00860  Porphyrin and chlorophyll metabolism
dre00980  Metabolism of xenobiotics by cytochrome P450
dre00982  Drug metabolism - cytochrome P450
dre00983  Drug metabolism - other enzymes
dre01100  Metabolic pathways
Module
dre_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    406731 (ugt1ab)
   00053 Ascorbate and aldarate metabolism
    406731 (ugt1ab)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    406731 (ugt1ab)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    406731 (ugt1ab)
   00860 Porphyrin and chlorophyll metabolism
    406731 (ugt1ab)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    406731 (ugt1ab)
   00982 Drug metabolism - cytochrome P450
    406731 (ugt1ab)
   00983 Drug metabolism - other enzymes
    406731 (ugt1ab)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     406731 (ugt1ab)
Glycosyltransferases [BR:dre01003]
 Others
  Hydrophobic molecule
   406731 (ugt1ab)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 406731
NCBI-ProteinID: NP_998587
ZFIN: ZDB-GENE-040426-2762
Ensembl: ENSDARG00000006220
Vega: OTTDARG00000010754
UniProt: F1R1P2
Position
9
AA seq 536 aa AA seqDB search
MPLCSTSFGGMKRTLFVPALGLFAFLCLFSSESVQAGKVLVMPVDGSHWLSMKILVEEMS
SRGHEMVVLVPETSILIGKSGNFTTKSFRVPYSFDELNAHVDHIRKTAIEKAPRFIDIVG
ALGNLIQFTNMQVKACEGLLYDEPLMKSLRDMKFDALLTDPFLPCGSVIADYFSIPAVYF
LRGIPCRLDEAAAQCPSPPSFIPRFFTGYTDKMTFPQRMINTFMTVFEKYLCHQLFASFD
ELATRYLKKDTSYAELLGHGAVWLLRYDFSFEYPKPQMPNMVQIGGINCAKRAPLTKELE
EFVNGSGEHGFVVFTLGSMVSQLPEAKAREFFEAFRQIPQRVLWRYTGPVPENAPKNVKL
MKWLPQNDLLGHPKVRAFVTHGGSHGIYEGICNGVPMVMLPLFGDQGDNAQRLVSRGVAE
SLTIYDVTSEKLLVALKKVINDKSYKEKMMKLSAIHRDRPIEPLDLAVFWTEFVMRHKGA
EHLRPAAHDLNWIQYHSLDVIGFLLLILLTVIFVTVKSCMFCFRKCFKKSQKKKKA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgcctctctgctccacaagttttggagggatgaagagaacactgtttgttcctgcactt
gggcttttcgccttcctgtgcttgttttcctctgagtctgtgcaagctggcaaggtgctt
gtcatgccagtggatggcagccattggttgagcatgaagatcctggtggaagagatgtct
agtaggggtcatgagatggtggtcctggtccctgaaactagtattctgattgggaagtct
gggaatttcaccaccaagtctttccgtgttccctactcctttgatgaactgaatgctcac
gtggaccacataagaaagacagcaattgagaaagctccaagattcattgatatcgtgggt
gctttgggaaatctgatccagttcactaatatgcaggtgaaagcctgtgaaggactgctg
tatgacgagcccctgatgaaaagtcttcgagacatgaaatttgacgctttgctcactgat
ccattcctgccctgtggctctgtcattgctgattacttctctattcctgctgtttacttc
ttacgtggaattccttgtcgtcttgatgaagcagctgctcagtgtccttcaccgccatca
tttattcctcgcttctttactggttacacagacaagatgactttcccccagagaatgata
aacactttcatgacagttttcgaaaagtacctatgccaccaactttttgccagctttgat
gaacttgccactagatatttgaagaaggacacctcatacgcagagctgttaggtcacggt
gcagtttggcttttaaggtacgacttcagctttgaataccctaaaccccaaatgccaaac
atggttcaaattgggggcatcaactgtgcaaagagggctccactaaccaaggaactggag
gagtttgtgaacggctctggagagcacgggtttgttgtcttcactctgggctccatggtg
tcacagctacccgaagccaaagccagagagttctttgaggcatttagacagatacctcag
agagtgttgtggagatacactggaccagtcccagaaaatgcaccaaagaatgtcaaatta
atgaaatggctgccacagaatgacctcttgggccatcctaaggttagggcttttgttaca
catggtggatcacatggaatctatgaaggaatctgtaatggagtgcctatggtgatgctt
cctctgtttggagaccaaggggataatgctcagcgtttggtgtctcgaggagtcgcagaa
agcctgactatctatgatgtgacctccgaaaaactgctggttgcattgaagaaagtcatc
aatgataaaagctacaaggagaagatgatgaagctctctgccattcatagagaccgtcca
attgaaccactggacctggctgtgttctggactgagtttgtcatgagacacaaaggagca
gagcatctcagacctgcagcccatgacctgaactggattcagtatcactctctggacgtc
atcggcttccttcttcttattctattgactgttatttttgtgactgtcaaaagctgcatg
ttctgtttcagaaagtgcttcaagaaatctcagaagaagaagaaggcataa

DBGET integrated database retrieval system