KEGG   Danio rerio (zebrafish): 406782Help
Entry
406782            CDS       T01004                                 

Gene name
mapk4, erk4, wu:fi27d11, zgc:55498
Definition
mitogen-activated protein kinase 4 (EC:2.7.11.24)
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
8
AA seq 674 aa AA seqDB search
MAWHNTSPFRYGFDLGAQYQDLRPLGTGASGLVLSALDRRSGLRVAVKKLVMRDAVSVKH
ALREVKITRRLQHENVVRVYDVLGSSGHPLPRDLTHVAAIYIVQECMETDLARLLEQGPL
PAEHATLLFYQLLRGLKFIHSANVLHRDLKPANIFINTEQMLLKIGDFGLARIVDPHYSH
KGYLSEGMVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGAHELEQMQLI
LDTVPVIREEDRQELLRVMPSLVGHGWQIRRSFRDLMPEVEDKAIDFLESILTFNPMDRL
TAEAALCQPFLQRYSCPQDEPVSLQPFRIEDELEDSLVTESTHTHGLRSHWDRYDSSLSS
DVYWPTQDQCGCMQSVSELGEAEDEEVQRDPRASSASHIEEAQVDPRKYSHSSSAERFLE
QSHPSLERICGHFSELDCGRSCDYKVGSPSYLDKIAWREGKPQHYSEPKLILDLSNWRNN
SMAAPRQNSAEKLLTEPGDLFQEISRWVETTQSGLHSPGSPQEPPSSPCSPPLPLSPTLM
PQSQIQIPAPLTLPSPLSRRSPTPFFSAPPSLLPSSPSSPHHGSSNYPSSSIGCENYEEP
SQMRPSGEEHFDLDVFISQALQICSQSEIMESSDDLKSDNISDVCNVSDDHRPSRTQTPT
PEMVKAHGCHKEHW
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcacaacacatcaccattccggtatggctttgacctgggggcacagtaccag
gatttgcgtcctctgggcacaggagcatccggtctggtgctttctgcactagacaggcgc
agcggccttcgtgtggcagtgaaaaagctggtaatgcgagatgccgtcagcgtaaaacac
gctctgagggaagtaaagatcacccgccgccttcagcatgagaacgtggtccgggtgtat
gacgtgttgggctcgtctggtcaccctttgccacgggacttgactcatgtggcggccata
tacatagtgcaagagtgtatggagactgatttggcacgactactcgaacaagggccgtta
ccagcagaacatgccaccctgctcttttatcagctgcttcgagggctcaagtttatccac
tcggccaacgtgctgcatcgtgacctgaagccagcgaacatctttatcaacacagagcaa
atgctgctgaagatcggagacttcggcctggcacgcattgtcgacccacattactcgcac
aagggttacctgtcagaggggatggtcactaaatggtaccgttcgcccagactgctgctg
tctccaaataactacacaaaagcgatcgacatgtgggccgcaggatgtattctggccgag
atgctcactggacgaatgctgttcgcaggtgctcatgaactggaacagatgcagctgatt
ctggacacggtgcccgtcatccgagaggaggacagacaggagctgctgagggtcatgcca
tctctagtgggtcacggctggcagatcaggagatccttcagagatctaatgccagaagtg
gaggacaaggccattgatttccttgagagtatcctgacctttaaccccatggatcgtctg
acggcagaagcggctctgtgtcagccgtttctgcagagatactcgtgtcctcaggatgag
ccagtgtctctgcagcccttccgcatcgaggacgagctagaggacagtctggtgactgag
agcactcacactcacgggctccgctcacactgggacaggtatgacagtagtctttcctca
gatgtttactggcctacccaggaccagtgtggctgcatgcagagcgtctcagaactcgga
gaagctgaagatgaagaagttcaaagggacccacgagccagttcagcttcccacatcgag
gaagcgcaggtagaccctcgcaagtactcccacagcagctctgcagagcgattcctggag
cagtcacacccatccctggagcgcatctgtggacacttcagcgagctggactgcggacgc
tcctgcgactacaaagtgggctctccatcctacctggacaagattgcatggagagaagga
aagccgcagcattactctgaacccaaactcatcctagacctttccaactggaggaacaac
agcatggctgctccaagacaaaacagcgcagagaagcttctgaccgaacctggagatctt
ttccaggagatctcgcgttgggtggagaccacacagtcaggtctccattcacctggttct
cctcaagaacctccatcttctccatgttcacctcctttaccgctttctccaacattgatg
cctcagtctcagattcagatcccagcgccgctgacattgcccagtcctctatccagaaga
agcccgacgccgttcttctccgctcctccatctctgctgccttcatctccttcatctcct
catcacggttcttccaattatccgtcttcctccattggttgtgaaaactatgaagagcct
tcacagatgcgtccatctggagaagaacatttcgacctggatgtgtttatctctcaggct
ctgcagatttgtagtcagagtgagatcatggagagctctgatgacctcaaatcagacaac
attagtgatgtctgcaacgtatcggacgaccacagaccttccagaacacaaactccaacc
cctgagatggtgaaggctcatggatgtcataaggagcactggtag

DBGET integrated database retrieval system