KEGG   Danio rerio (zebrafish): 406790Help
Entry
406790            CDS       T01004                                 

Gene name
usp25, wu:fi33c05, wu:fo67e06, wu:fp97a04, zgc:55791
Definition
ubiquitin specific protease 25 (EC:3.4.19.12)
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     406790 (usp25)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   406790 (usp25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
10
AA seq 1072 aa AA seqDB search
MTVEQNVLQQHSQKHQQTLLNQLREVTGTTDVQLLQQALQVSNGDLVEAVAFLTEKNAKV
PQQDEATYYQTAQITNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLEESNRAFRETG
ITDEEQAISRVLEASIAENKASLKRTHTEVWSDSPNPHERKRMENCPVGLKNVGNTCWFS
AVIQSLFNLLEFQRLVLHYSPPARMQDLPRNQKEHRNLPFMQELRHLFSLLVGSKRKYVD
PSGAVEILKDAFKSSESQQQDVSEFTHKLLDWLEDAFQIKAEEDREGEKPKNPMVELFYG
RFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLHSAENSAKSGQE
HWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPSMLYMDSYMDRNREITRIKREEIR
RLKEHLTVLQQRLERYLSYGSGPKRFPLADVLQYAMEFASSKPVCTSPVEDIDTTAPPGG
TIAQLPPPASAGEQPDACVSAEGSGSGLQASQQQQQRVSIHKPFTQSRVPPDLPMHPAPR
HITEEELRVLESCLHRWRSEVENDTRDLQASISRIHRTIELMYSDKSMMQVPYRLHAVLV
HEGQANAGHYWAYIYDRHHQRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLMYIDDK
KPFLIQEEFDKETGQMLSGLDKLPPDLKVFVEADNKLFEREMEEWDALQARKLQQEKLAL
AAAAAAAAAASVAVQPMSTEPCSPDNTAPQHDPEYMEQQSPSGDSKHLQEDTERAISKAA
AEHDEKSPEALLNTAMKVEYTRLLRLAQEDTPPERDYRLQHVIVFFIHNEAPKKIVERTL
LMQFADRNLGFDERCKSIMKVARAKLELIKPDEVNMEEYEMWHQDYRIFRETSVFLLIGL
ELFMKKSFVEALMYLIYAYQYNKELLAKGPYRGHDEELIAHYRRECLLKLNEYAAALFET
GEEAKVNTGLSIMNDLVVPCLPLLLVDEMEEKDMVAVEDMRNRWCSYLGQEMEPNLQEKL
TDFLPKLLDCSTEIKSFHEPPKLPSYSTLELFERFGRVMTSLTMGRTPADGR
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtggagcagaatgtcctgcagcagcactctcagaagcaccagcagacattactg
aaccagctgagggaagttactggaactacagatgttcaactgttacagcaggcactgcag
gtcagtaatggtgacctagtggaggctgttgcctttctcactgagaagaacgccaaagtg
ccgcagcaagatgaagccacctattaccagacggcccaaatcactaacgacagatacatc
agcgtgggcagccaggctgacacaaatgtaattgacctgactggagatgataaagatgac
ctccagcgggccatcgctctcagtctggaggagtcaaacagagccttcagggagacgggc
atcaccgatgaagagcaggccatcagcagagtcctggaggcgagcatcgcagagaacaag
gccagcctgaagcgaacacacactgaagtgtggagcgattcaccaaaccctcacgagcgc
aagaggatggagaactgtcctgtaggactgaagaatgtgggaaacacttgctggttcagt
gctgttatacagtctctttttaacctgctggagtttcagaggctggtgttgcattattcc
cctcctgcacggatgcaggacctgccccgcaatcaaaaggagcacaggaacctgcccttc
atgcaggagcttaggcatctcttctccttgttggtgggctccaagcggaagtatgtggac
ccgtccggggccgtggagatcctcaaagatgccttcaagtccagtgagtctcagcagcag
gatgtgagcgagttcactcataaacttctggactggctggaggacgcgtttcagattaaa
gcagaagaggacagggagggagagaaacccaagaacccgatggttgagctgttttatgga
cgtttcctggctgtgggcgtcctggagggaaagaaatttgaaaacaccgagatgtttggc
cagtatcctctccaggtgaacggcttcaaagatctacacgagtgtttagaggccgcaatg
atagagggagaaatcgagtctttgcattctgcagaaaactccgccaaatcaggccaagag
cattggttcacagagcttccacccgttttgacctttgaactgtccaggtttgagtttaat
caagccttaggccgacctgagaagattcacaataagctcgagtttccttctatgctgtac
atggacagttacatggacaggaaccgagagatcacacggataaagcgagaggagatcaga
agactaaaggagcacctgaccgtcctccagcagcgactcgagaggtatctgagttatggc
tcggggcccaagcgctttcctctggctgatgttctccaatatgccatggagtttgcgtcc
agtaaaccagtgtgcacgtctccagtggaggacattgatacaacagcaccacctggtggc
acgattgcgcagctgccaccgccagcaagcgcaggggaacagccggatgcgtgcgtctca
gccgagggctctggttctggtctgcaggcttcgcaacagcagcaacagagggtttccatc
cataaaccgttcacacagtcccgagtgccgccggatctgcccatgcatcccgctcctcga
cacatcactgaggaggagctgcgggtgctggagagctgcctgcaccgctggaggagcgag
gtggagaacgacactagagatctgcaggccagcatatccagaatccacagaaccatcgag
ctcatgtattctgacaagtctatgatgcaggtgccgtatcgactacatgctgttctggtc
cacgagggtcaggcgaatgctggtcactactgggcctacatttatgaccgacatcaccag
cgctggatgaaatacaacgacattgcagtgacaaagtcatcatgggaagagctagtgcgg
gactcgtttggtggatatcgtaacgccagcgcatactgcctcatgtacattgatgataag
aaacccttccttattcaagaagagtttgataaagagacgggacagatgctcagtggtttg
gacaagcttcctcctgacctgaaggtgtttgtggaggcagataacaagctcttcgagagg
gagatggaggagtgggatgctttacaggcccgcaaactccagcaggaaaagttggctctg
gctgctgctgctgcggctgctgccgccgctagtgtggccgtccagcccatgagcactgaa
ccctgctctccagacaacacagctcctcagcatgacccagagtacatggagcaacagtcg
cccagcggagactccaaacacctgcaggaggacacagagagagccatcagcaaggctgca
gcggagcatgatgagaagagtccagaagccctgcttaatacagcgatgaaggttgagtac
acgcgtttgctgaggcttgctcaggaggacacgccgcccgagagagactaccggctacag
catgtcattgtgttctttattcacaatgaggcgcccaagaagattgtggagagaacattg
ctcatgcagtttgctgacagaaaccttggcttcgatgagaggtgtaaaagcatcatgaaa
gtggcacgtgccaaactggagctcatcaagcctgatgaggtgaacatggaggagtacgag
atgtggcatcaggactacaggattttccgtgagacgtcagtgttcctgttgatcggcctg
gaattattcatgaagaaaagttttgtggaagcgttgatgtatctgatctacgcctatcag
tacaacaaagagcttctggcgaaagggccgtacagaggccatgatgaggagctgatcgca
cattaccgcagagagtgcctgctgaagttaaatgaatacgctgccgctttgttcgagacg
ggcgaggaggctaaagtgaacacgggtctgagcatcatgaacgatctggtggtgccctgt
cttcctctgttactggtggatgagatggaggagaaggacatggtggctgttgaagacatg
aggaaccgatggtgctcatacctgggccaggaaatggagccgaatctacaggagaagctg
accgacttcctccccaaactgctggactgctcgaccgagatcaaaagctttcacgagccg
cccaaactgccctcttactccacgctggagctgttcgagcgcttcggcagggtcatgacg
tccctcactatgggtcgaacccctgcagatggcagatga

DBGET integrated database retrieval system