KEGG   Danio rerio (zebrafish): 406823Help
Entry
406823            CDS       T01004                                 

Gene name
eif3jb, wu:fi35e11, zgc:55443
Definition
eukaryotic translation initiation factor 3, subunit Jb
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
dre  Danio rerio (zebrafish)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    406823 (eif3jb)
Translation factors [BR:dre03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    406823 (eif3jb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
7
AA seq 263 aa AA seqDB search
MADSDEWDADNFEPNEPIKIATAGRLDRWEGEDEEEDVKDNWDDEEEEKEEEKKVEQKIA
EVKPPEKKKLSDKIKEKELLQKKKQEELKKNQETAASESLTLEEQLAEKARLKKLQEEAD
MELAREAFGVDPAAANASTTVNTTNASGIEAMCPSSKDDFVTFEKLLKEKITQFEKSVHY
PSFLESLFRELCISLEVDDLKKISTSLSVLLTEKQKQEKEKKANKKKKKGVVPGGGLKAN
MKDDFADYGGFDGGYGNEYDDFM
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcggattcagacgaatgggatgctgacaacttcgagccaaatgagccgattaaaatt
gccaccgccgggcggctggacagatgggaaggcgaggacgaggaggaagacgtaaaggat
aactgggatgatgaggaggaggagaaggaggaggagaagaaagttgaacagaaaatagct
gaagtgaaacctcctgagaagaaaaaattaagtgacaaaataaaagagaaagaacttttg
caaaagaaaaaacaagaggagttgaaaaagaatcaggaaacagcagctagtgagagtctg
acgttagaggagcagctagcagaaaaagctagactgaaaaagctgcaggaggaggcagac
atggaattggcccgtgaggcttttggtgtggatcctgctgctgcaaatgcctcaactact
gttaacacaacaaacgcctctggaattgaagccatgtgcccttcatccaaagatgacttt
gttacatttgaaaaattactgaaagaaaagataacacagtttgaaaaatctgtgcattat
ccaagctttttggaatcattgtttcgagaactttgtatttcattggaagtagacgacctg
aagaaaatatctacttctttatcagttctgctcactgaaaaacaaaagcaagaaaaggaa
aagaaggcaaataagaaaaagaaaaaaggtgttgtacctggtggtggattgaaagcaaac
atgaaagatgactttgctgactatggtggttttgacggtggttacggcaatgaatatgat
gacttcatgtga

DBGET integrated database retrieval system