KEGG   Danio rerio (zebrafish): 407651Help
Entry
407651            CDS       T01004                                 

Gene name
prlra, prlr, wu:fj65c07
Definition
prolactin receptor a
Orthology
K05081  
prolactin receptor
Organism
dre  Danio rerio (zebrafish)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    407651 (prlra)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    407651 (prlra)
   04060 Cytokine-cytokine receptor interaction
    407651 (prlra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
21
AA seq 605 aa AA seqDB search
MRISAAVLILTLIADLISQAAGVSPPGKPRLTSCRSPEKETFTCWWEPGDDGGLPTTYAL
YYRLENTETVKECPDYKTAGENSCFFDKNATSLWVNYNITVVATNALGRNISEPVEVDVV
YIVQPNTPENVKAVVIHEDRDPFVKVSWDKPRTADTRSGWITLHYQLRVKQEEDKEWVEY
DAERQKNYNVFSLHSDREYMVQVRCKPDHGFWSEWTQTTYVKMPNYIPRERSLWIMITIF
SVFIVFILTWMLKVKHNSVKLCLLPPVPGPKIKGFDKQLLKSGKSEEVFNSLVIPGFPPT
TDYDDLLVEYLEVYDNEEQELVLDGKDLSEDSMKSKSPSDSDSGRGSCDSRTLLLDKCME
GSGNDQHNYSQHGETSWASSSECSESQGSPGSPESTDGRMKTWPVVFSSPQPHHHYQVGA
TKPAYHSVPEILKHSPSHAIPSNYHQLYLQDIPPQEGRFTKPPCRHSQSYNQFNMDNVDI
SEAGVPPSRSLEYVEVQRVNPENILLLRPLSDPNREPEGSDRIDEDYSKVKEVTSNNTLL
LQRETSHQVVNDYSQDFESYADQCTAQQTPHPCKPVMTQLHSQDMRVMGNGYVDTTVLMP
LYKQF
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgaggatttccgccgctgtgctgattttgaccttaattgcagatttaatatcgcaagca
gcaggtgtcagtcctccaggcaaacccagactgaccagctgtcgctccccagagaaggag
accttcacctgctggtgggagcctggagatgatggaggtctgcccactacatatgccctc
tactaccgcctggagaacaccgagacggtcaaagagtgtcccgattacaaaaccgcaggc
gagaactcctgtttcttcgacaaaaatgccacatcgctgtgggtgaactacaacatcaca
gtagtggccaccaatgctttgggcaggaacatttcagaacccgtggaggtggatgtcgtc
tatattgttcaaccgaatactccggaaaacgtcaaagcggttgtgattcacgaggaccgg
gatccattcgtcaaagtttcctgggacaaaccacggaccgcagacacccgatctggatgg
atcacactgcattaccagctacgggttaaacaagaagaggataaagaatgggtggaatat
gatgctgaaaggcaaaagaactataacgtgttcagccttcactctgatagagaatacatg
gtgcaggtgcggtgtaaaccagatcatggcttctggagtgaatggacacaaaccacctac
gtcaaaatgcccaactatattcccagagagcgttcgttgtggatcatgatcacgattttc
tctgtcttcatcgtctttatcctcacctggatgctcaaagtgaaacacaacagtgtgaag
ctttgtttgctgcctcctgttcctgggccgaaaatcaaaggatttgacaaacagcttctc
aagagcgggaaatcagaggaagttttcaattctctggtaatcccaggtttccctccaacc
actgattacgacgatctactagtggagtacctcgaggtgtacgacaacgaggagcaagag
ctggtcctggatggtaaagatctatcagaggacagcatgaaatccaaaagcccatctgac
agcgactcgggcaggggcagctgcgacagtcgtaccctgcttttagacaagtgcatggaa
ggaagtggaaatgaccaacacaactacagccagcacggagaaacaagctgggcttcttcc
agcgaatgtagcgaaagccaaggttcacctggttctccagagtccaccgatggacgcatg
aaaacctggcctgttgtgttttcctcaccccaaccgcatcaccactaccaagtcggagcg
acaaaaccggcctaccacagcgtcccggagatcctaaaacattcaccatcacacgcaatc
ccaagcaactaccaccagctttaccttcaggacatcccgccgcaggaagggcgctttact
aaacctccctgccggcattcccaaagctacaaccagttcaacatggacaacgttgacatt
tccgaagccggtgttcctccatctcgctccttggagtatgtagaggtgcagagggtcaac
ccggaaaacatactactgcttaggccactttcagacccaaaccgtgaacctgaagggtca
gatcgcatcgatgaggactacagcaaggtcaaagaagtgacgtcaaacaatactctcctt
ctccaaagagaaacgtctcatcaggttgtcaatgattacagccaggactttgaaagctat
gctgatcaatgcacagcccagcaaactcctcacccatgcaaacctgtcatgacacagttg
cacagtcaagacatgagggtgatgggaaacggttacgtggacacaacagtcctgatgcca
ttatacaagcaattctaa

DBGET integrated database retrieval system