KEGG   Danio rerio (zebrafish): 407659Help
Entry
407659            CDS       T01004                                 

Gene name
st3gal3b, im:6892850, siat6l, st3gal3l
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 3b
Orthology
K00781  
N-acetyllactosaminide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
dre  Danio rerio (zebrafish)
Pathway
Other types of O-glycan biosynthesis
Glycosaminoglycan biosynthesis - keratan sulfate
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    407659 (st3gal3b)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    407659 (st3gal3b)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    407659 (st3gal3b)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     407659 (st3gal3b)
Glycosyltransferases [BR:dre01003]
 Terminal extension
  Sialyltransferase
   407659 (st3gal3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
2
AA seq 355 aa AA seqDB search
MKPAHKLLFVVCPMLVLGFIYYSSGKLHLHVWGQKPLFDKQGFMLNLDTKLPLDLAYKYG
NLSEGACKPGYAAAKMTAIYPKSKPASMFLDRNFKRLAKVINYLPPFGFRTQERIIDVIL
SATKNYGLGPELDSLICKRCIIVGNGGILSNKSLGSRIDEYDVVVRLNEAPVSGYTRDVG
SKTTMRITYPEGAIQKPERYEKDSLFVFSAFKPLDFKWLRQMVYKEKLVRLEGFWKSVAR
YVPREPSEIRILNPYFIQEAAFQFIGLPQNNGLMGKGNIPTLGTVAITMALHNCDEVAVA
GFGYDMNTPHAPLHYYESVKMSAIKESWTHNISKEKEFLRKLVKANIITDLTNGI
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgcacacaaactactgttcgtcgtgtgtcccatgctggtcttggggttcatc
tactactcttctgggaagctccatttgcacgtatggggccaaaagccactgtttgataag
caagggttcatgctgaatctggacacaaagctgcctctggatctggcgtacaagtatgga
aacctcagtgaaggagcctgcaaacctggctatgcagctgccaaaatgactgctatctat
ccaaagagtaagccagcttctatgtttctggaccgaaactttaagaggcttgcaaaagtg
atcaactatttacctccatttggattcagaacacaagaaagaatcatagatgttatatta
tccgctacaaagaattatggactgggtccagaactggacagtttgatttgtaaaagatgt
atcatagtgggcaatggcggtatccttagcaacaagtctttaggatcccgcattgatgaa
tatgatgttgtggtaaggctcaatgaagccccagtgagcggttacaccagagacgtaggt
agtaagaccaccatgaggattacctaccctgagggggccatccagaagcctgagcgctac
gagaaagattcgctctttgtcttctctgctttcaaacctctcgactttaaatggctgaga
cagatggtctacaaagagaaactggtaagactggagggcttctggaagtctgtagcacga
tatgttccccgggaaccctcagaaatacggattctcaacccctactttatacaagaggct
gcctttcagtttattggccttccacagaacaatggcctcatgggtaaagggaacattcca
acgttgggcaccgttgccattacgatggccctacataactgcgatgaggtcgctgttgct
ggatttggctatgacatgaacacccctcatgcacccttgcactactacgaatcagtcaaa
atgtctgccattaaagagtcatggactcacaacatctcaaaggaaaaggaatttctccga
aagttggtgaaggccaacatcattacagacttaaccaatgggatttga

DBGET integrated database retrieval system