KEGG   Danio rerio (zebrafish): 407659Help
Entry
407659            CDS       T01004                                 

Gene name
st3gal3b, im:6892850, siat6l, st3gal3l
Definition
ST3 beta-galactoside alpha-2,3-sialyltransferase 3b
Orthology
K00781  
N-acetyllactosaminide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
dre  Danio rerio (zebrafish)
Pathway
Other types of O-glycan biosynthesis
Glycosaminoglycan biosynthesis - keratan sulfate
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:dre00514]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan biosynthesis - keratan sulfate [PATH:dre00533]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - lacto and neolacto series [PATH:dre00601]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
2
AA seq 355 aa AA seqDB search
MKPAHKLLFVVCPMLVLGFIYYSSGKLHLHVWGQKPLFDKQGFMLNLDTKLPLDLAYKYG
NLSEGACKPGYAAAKMTAIYPKSKPASMFLDRNFKRLAKVINYLPPFGFRTQERIIDVIL
SATKNYGLGPELDSLICKRCIIVGNGGILSNKSLGSRIDEYDVVVRLNEAPVSGYTRDVG
SKTTMRITYPEGAIQKPERYEKDSLFVFSAFKPLDFKWLRQMVYKEKLVRLEGFWKSVAR
YVPREPSEIRILNPYFIQEAAFQFIGLPQNNGLMGKGNIPTLGTVAITMALHNCDEVAVA
GFGYDMNTPHAPLHYYESVKMSAIKESWTHNISKEKEFLRKLVKANIITDLTNGI
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgcacacaaactactgttcgtcgtgtgtcccatgctggtcttggggttcatc
tactactcttctgggaagctccatttgcacgtatggggccaaaagccactgtttgataag
caagggttcatgctgaatctggacacaaagctgcctctggatctggcgtacaagtatgga
aacctcagtgaaggagcctgcaaacctggctatgcagctgccaaaatgactgctatctat
ccaaagagtaagccagcttctatgtttctggaccgaaactttaagaggcttgcaaaagtg
atcaactatttacctccatttggattcagaacacaagaaagaatcatagatgttatatta
tccgctacaaagaattatggactgggtccagaactggacagtttgatttgtaaaagatgt
atcatagtgggcaatggcggtatccttagcaacaagtctttaggatcccgcattgatgaa
tatgatgttgtggtaaggctcaatgaagccccagtgagcggttacaccagagacgtaggt
agtaagaccaccatgaggattacctaccctgagggggccatccagaagcctgagcgctac
gagaaagattcgctctttgtcttctctgctttcaaacctctcgactttaaatggctgaga
cagatggtctacaaagagaaactggtaagactggagggcttctggaagtctgtagcacga
tatgttccccgggaaccctcagaaatacggattctcaacccctactttatacaagaggct
gcctttcagtttattggccttccacagaacaatggcctcatgggtaaagggaacattcca
acgttgggcaccgttgccattacgatggccctacataactgcgatgaggtcgctgttgct
ggatttggctatgacatgaacacccctcatgcacccttgcactactacgaatcagtcaaa
atgtctgccattaaagagtcatggactcacaacatctcaaaggaaaaggaatttctccga
aagttggtgaaggccaacatcattacagacttaaccaatgggatttga

DBGET integrated database retrieval system