KEGG   Danio rerio (zebrafish): 407735Help
Entry
407735            CDS       T01004                                 

Gene name
gria4a, glur4a, gria4, iGluR4
Definition
glutamate receptor, ionotropic, AMPA 4a
Orthology
K05200  
glutamate receptor 4
Organism
dre  Danio rerio (zebrafish)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    407735 (gria4a)
Ion channels [BR:dre04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   407735 (gria4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
15
AA seq 898 aa AA seqDB search
MRILVLIPLLWGLGEGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNATEAPFNLV
PHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLVTPSFPAE
GETQFVLQLRPSIRGALLSLLDHYDWSRFVFLYDTDRGYAVLQAIMEKAGQNGWQVSAIC
VENFNDASYRRLLEDLDRRQEKKFVIDLEAERLQNILEQIVSVGKHVKGYHYIVANLGFK
DISLERFMHGGANVTGFQLVDFSKPMVIKLMQRWNKLDQREYPGSESPPRYTSSLTYDGV
LVMAEAFRNLRRQKIDISRRGNAGDCLANPAAPWNQGIDMERTLKQVRIQGLTGNIQFDH
YGRRVNYTMDVFELKSNGPRKIGYWNDLDKLVLVQNELSMGNDSAMENRTVIVTTIMEGP
YVMLKKNWEMYEGNEQFEGYCVDLASEVAKHIGIKYKISIVLDGKYGARDPETKIWNGMV
GELVYGKAEIAVAPLAITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYE
IWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGSDGPPSDQPPNEFGIFNSLWFSLGA
FMQQGCDFTPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQT
EIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFL
LESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSQLGTPVNLAVLKLSEAGVLDKLK
NKWWYDKGECGPKDSGSKDKSSQALSLSNVAGVFYILVGGLGLAMLVALVEFCYKSRAEA
KKLKLTFSEAMRNKARLSITGSLGENGRVLTPDCPKAVHSGPSYRHGPALAVVSSDLP
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcctggtgttgattccgctgctgtggggactcggtgaaggggcttttcccagc
agtgtccaaatcggtggattgtttataagaaacacagatcaagaatatacagctttccgc
ttggccatatttcttcataacacgagtccgaatgccacagaagccccattcaacctggtt
ccacatgtcgacaacatcgagacggcaaacagctttgctgtcaccaatgccttctgttcg
cagtattcacgaggagtgtttgcgatattcggcctgtatgacaagcgttcggttcacact
ctgacatcgttctgcagtgccctgcacatctctctggtgacgcccagtttccccgccgag
ggcgagacccagttcgtcctgcagctgcgtccgtccatccgcggagccctgctgagcctg
ctggaccactatgactggagccgcttcgtgttcctgtacgacactgacagaggatatgcc
gtcctgcaggccatcatggagaaggcgggtcagaacggttggcaggttagtgccatctgt
gtggagaactttaatgacgccagctatcgacgtctgctggaggacctggatcgacggcag
gagaagaagttcgtcattgacctcgaggcagagcgactgcagaatatactagaacagatt
gtgagcgtggggaaacatgtgaaaggatatcactacatcgtcgctaacctgggttttaag
gatatttctcttgagaggtttatgcatggcggggcgaacgtaactggtttccagttggtg
gatttcagcaaaccgatggtgatcaaactaatgcagcgctggaacaaactagaccagagg
gagtatccgggatctgaaagcccacccaggtatacatcatcattgacgtatgatggtgta
ctagtgatggcggaggcatttcggaacctgcgtagacagaagatcgacatctctcgcaga
ggcaatgctggagactgcctggccaacccagctgctccttggaatcagggaatcgacatg
gaacgaactctgaaacaggtgagaatccagggtctcacgggaaatatccagtttgatcat
tatggacgtcgagtcaactacaccatggacgtctttgagctaaagagtaacggcccccgc
aagatcggttactggaacgacctggataaattggtactcgtccagaatgagctctctatg
ggcaatgactccgcaatggagaacaggacggttatcgtcacaactataatggaagggccg
tatgtgatgttgaagaagaactgggagatgtacgaggggaacgagcagtttgaaggttac
tgtgtggatctggcgtctgaagtcgccaaacatatcggcatcaagtacaagatctcaatc
gtgctggatgggaaatacggagccagagacccagagacgaagatctggaacggcatggtt
ggggagctggtgtacgggaaagcggaaatagctgtggcccctttggccatcactctggtc
cgggaggaggtgattgatttctccaagcccttcatgagtctgggcatctccatcatgatc
aagaagccgcaaaagtccaaacccggcgtcttctccttcctggacccgctggcctacgag
atctggatgtgcatcgtgttcgcctacatcggcgtgagcgtggtgctcttcctggtcagc
cgcttcagcccgtacgagtggcacaccgaggagcccgaggaaggctccgacggtccgccc
agcgaccagccccccaatgagttcggcatcttcaacagtctctggttctcccttggcgca
ttcatgcagcagggctgcgacttcacacccaggtctctgtctgggcgcatagtcggagga
gtttggtggttcttcactctcatcattatttcctcctacactgcaaacctggcagctttc
ctgaccgtggagagaatggtgtcgcccatcgagagcgcagaagacctggccaagcagaca
gagatcgcctacgggactctcgattcgggctccaccaaagagttcttcaggagatcgaaa
atcgcggtgtatgaaaaaatgtggagttacatgaagtcagcggagcccaccgtcttcacc
aagaccacagcagagggcgtcgctcgagtccgcaagtccaaaggcaaatacgccttcctg
ctggagtccaccatgaacgagtacacggaacagcgcaagccctgcgacaccatgaaggtc
ggagggaatctggactccaagggctacggcgtcgccacgcctaaaggatcgcagctggga
acgccggtaaacctggcggtgttgaaactgagtgaagcaggagtgctagacaaactcaaa
aataaatggtggtacgataagggcgagtgcggacccaaggactcgggaagtaaggacaag
agttcgcaggctctgagcctcagcaacgtggcgggggttttctacatcctggtgggcggc
ctgggtctggccatgctggtggccctggtcgagttttgctataagtcccgcgccgaggcc
aagaaactgaagctcaccttctcggaagccatgagaaacaaagcccgcctgtcaatcacg
ggcagcctgggggaaaatgggcgtgtcctgacgccagactgccctaaggccgtgcactct
ggcccctcctaccgacatggccccgccctcgccgtggtgtcctccgacctcccatag

DBGET integrated database retrieval system