KEGG   Danio rerio (zebrafish): 407980Help
Entry
407980            CDS       T01004                                 

Gene name
ppp1caa, wu:fc04c08, wu:fc09b07, wu:fc30g11, wu:fe05h08, zgc:85729
Definition
protein phosphatase 1, catalytic subunit, alpha isoform a
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dre  Danio rerio (zebrafish)
Pathway
mRNA surveillance pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Focal adhesion
Regulation of actin cytoskeleton
Insulin signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    407980 (ppp1caa)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    407980 (ppp1caa)
  Cell growth and death
   04114 Oocyte meiosis
    407980 (ppp1caa)
  Cell communication
   04510 Focal adhesion
    407980 (ppp1caa)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    407980 (ppp1caa)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    407980 (ppp1caa)
   04270 Vascular smooth muscle contraction
    407980 (ppp1caa)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    407980 (ppp1caa)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     407980 (ppp1caa)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     407980 (ppp1caa)
Transcription machinery [BR:dre03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     407980 (ppp1caa)
Spliceosome [BR:dre03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    407980 (ppp1caa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
3
AA seq 331 aa AA seqDB search
MAEPDKLNIDSIIQRLLEVKGSRPGKNVQLTESEIRGLCLKSREIFLSQPILLELEAPLK
ICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDL
QSMEQVRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKFLHKHD
MDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KKLYYGGGGGMGSGRPVTPPRNSAKGGKAKK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccggacaaattaaacattgactccataatacagcgtctcctggaagttaaa
ggctccaggccaggcaagaacgtacagctgacagagagtgaaattcgtggcctctgtctc
aaatcgagggaaattttcctcagccagcctatcctgctggagctggaagcaccgctcaag
atctgtggtgatgtccatggtcagtactatgatcttcttcgtctcttcgagtatgggggc
tttcctcctgagagtaactacttgttcctgggggactatgtggacagagggaagcagtcc
ctagagacaatctgcctcctgttggcctacaaagtcaaatatcctgaaaacttcttcctg
ctgcgtggcaaccacgagtgcgcctctatcaatcgtatatatggcttctatgatgagtgt
aagcggcggtataacattaagctgtggaagaccttcacggactgtttcaactgtttacct
gtggctgccattgtagacgagaagatcttctgttgccatggaggcctctctccagacctg
cagtcaatggagcaggtgcggcgtgtcatgcggcccacggacgtgcctgaccaggggctg
ctttgtgacctgctttgggccgacccagataaagacgtgctgggatggggagagaatgac
cgcggtgtgtccttcaccttcggtgcagacgtagtggccaaatttcttcacaaacatgac
atggacctaatatgtagggcgcatcaggtggtggaagacggttatgagttttttgcaaag
agacagttagtcaccctgttctccgctcctaactactgtggcgagtttgataacgccggg
gccatgatgagtgtggatgaaacactcatgtgttctttccagatcctcaagccagccgat
aagaagctgtactacggtggaggaggaggaatgggctcaggtcgcccggtcaccccgccg
cgaaattcagccaagggtggaaaagccaagaaataa

DBGET integrated database retrieval system