KEGG   Danio rerio (zebrafish): 407980Help
Entry
407980            CDS       T01004                                 

Gene name
ppp1caa
Definition
(RefSeq) protein phosphatase 1, catalytic subunit, alpha
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03015  mRNA surveillance pathway
dre04114  Oocyte meiosis
dre04218  Cellular senescence
dre04261  Adrenergic signaling in cardiomyocytes
dre04270  Vascular smooth muscle contraction
dre04510  Focal adhesion
dre04810  Regulation of actin cytoskeleton
dre04910  Insulin signaling pathway
dre05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    407980 (ppp1caa)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    407980 (ppp1caa)
   04218 Cellular senescence
    407980 (ppp1caa)
  Cellular community - eukaryotes
   04510 Focal adhesion
    407980 (ppp1caa)
  Cell motility
   04810 Regulation of actin cytoskeleton
    407980 (ppp1caa)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    407980 (ppp1caa)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    407980 (ppp1caa)
   04270 Vascular smooth muscle contraction
    407980 (ppp1caa)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    407980 (ppp1caa)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     407980 (ppp1caa)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     407980 (ppp1caa)
Transcription machinery [BR:dre03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     407980 (ppp1caa)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     407980 (ppp1caa)
Spliceosome [BR:dre03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    407980 (ppp1caa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 407980
NCBI-ProteinID: NP_999976
ZFIN: ZDB-GENE-040516-3
Ensembl: ENSDARG00000003486
Vega: OTTDARG00000021758
UniProt: Q6NSN6
Position
3
AA seq 331 aa AA seqDB search
MAEPDKLNIDSIIQRLLEVKGSRPGKNVQLTESEIRGLCLKSREIFLSQPILLELEAPLK
ICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDL
QSMEQVRRVMRPTDVPDQGLLCDLLWADPDKDVLGWGENDRGVSFTFGADVVAKFLHKHD
MDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KKLYYGGGGGMGSGRPVTPPRNSAKGGKAKK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccggacaaattaaacattgactccataatacagcgtctcctggaagttaaa
ggctccaggccaggcaagaacgtacagctgacagagagtgaaattcgtggcctctgtctc
aaatcgagggaaattttcctcagccagcctatcctgctggagctggaagcaccgctcaag
atctgtggtgatgtccatggtcagtactatgatcttcttcgtctcttcgagtatgggggc
tttcctcctgagagtaactacttgttcctgggggactatgtggacagagggaagcagtcc
ctagagacaatctgcctcctgttggcctacaaagtcaaatatcctgaaaacttcttcctg
ctgcgtggcaaccacgagtgcgcctctatcaatcgtatatatggcttctatgatgagtgt
aagcggcggtataacattaagctgtggaagaccttcacggactgtttcaactgtttacct
gtggctgccattgtagacgagaagatcttctgttgccatggaggcctctctccagacctg
cagtcaatggagcaggtgcggcgtgtcatgcggcccacggacgtgcctgaccaggggctg
ctttgtgacctgctttgggccgacccagataaagacgtgctgggatggggagagaatgac
cgcggtgtgtccttcaccttcggtgcagacgtagtggccaaatttcttcacaaacatgac
atggacctaatatgtagggcgcatcaggtggtggaagacggttatgagttttttgcaaag
agacagttagtcaccctgttctccgctcctaactactgtggcgagtttgataacgccggg
gccatgatgagtgtggatgaaacactcatgtgttctttccagatcctcaagccagccgat
aagaagctgtactacggtggaggaggaggaatgggctcaggtcgcccggtcaccccgccg
cgaaattcagccaagggtggaaaagccaagaaataa

DBGET integrated database retrieval system