KEGG   Danio rerio (zebrafish): 415099Help
Entry
415099            CDS       T01004                                 

Gene name
rela, nfkb3, p65
Definition
(RefSeq) v-rel avian reticuloendotheliosis viral oncogene homolog A
  KO
K04735  
transcription factor p65
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Apoptosis
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Adipocytokine signaling pathway
Insulin resistance
Salmonella infection
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    415099 (rela)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    415099 (rela)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    415099 (rela)
   04621 NOD-like receptor signaling pathway
    415099 (rela)
   04622 RIG-I-like receptor signaling pathway
    415099 (rela)
   04623 Cytosolic DNA-sensing pathway
    415099 (rela)
  Endocrine system
   04920 Adipocytokine signaling pathway
    415099 (rela)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    415099 (rela)
  Infectious diseases
   05132 Salmonella infection
    415099 (rela)
   05168 Herpes simplex infection
    415099 (rela)
Transcription factors [BR:dre03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    415099 (rela)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
7
AA seq 455 aa AA seqDB search
MDGMFHQWGTSQVPQGPPHVEIIEQPKSRGMRFRYKCEGRSAGSIPGEKSNDTTKTHPAI
RVHNYSGPVRVRISLVTKNQPYKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQCVK
KKDVGEAVSCRLQTQNNPFKIPDAKIWEEEFDLNAVRLCFQVSITLSSGDLFPLEPVVSQ
PIYDNRAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFFLDSWESKGSFSQ
ADVHRQVAIVFRTPPYCDTNLTEPLRVKMQLRRPSDREVSEPMDFQYLPSDPDEHRLMEK
RKRTEGMLHNLKLSSIITGSSMSAERRPFPTAKRTLPVSKQPVAASAPASVPAVSAAPPL
KPPPTSFFSPPPGQLFTQQKMEPSPLPASSSDIWKYLQAMSVDSQPKAVPVLPFPSGTVS
TGRDARLITAARGENTVLHPYTLHYTHLTHVLLLV
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggacggaatgtttcaccagtggggaacttcgcaggtgcctcaaggtcctccacatgtg
gagatcatcgagcagcctaaatctcgagggatgcgtttccgttataagtgtgagggtcga
tcggccggcagcatccctggagagaagagcaacgacaccacgaaaacgcaccccgccatt
agggttcacaactacagtgggccagtcagagtgcggatctccttggtaaccaagaatcag
ccgtataagccacacccacacgagctggtgggaaaagactgtaaacatggctactatgag
gcagatctgcaggagcgcaggatacacagtttccagaatctgggtattcagtgtgtgaag
aagaaggatgtgggagaagctgtttcctgcagactgcagacgcaaaacaacccattcaag
attcctgacgcaaagatctgggaggaggagttcgacctgaacgcggtgcgtctgtgtttc
caggtctccatcaccctgagcagcggagatctgttccctctggagcccgtcgtctctcag
ccgatatacgacaacagagctcctaacactgctgagctgaagatctgccgtgtcaataga
aactccggcagctgtcgaggaggagacgagattttcctgctgtgtgataaagtacagaaa
gaggacattgaggtgcgcttcttcctggactcgtgggagagtaagggctcgttctctcag
gctgatgtgcaccggcaggtggcgatagtgttccgcacgccgccctactgcgacactaac
ctgaccgagccgctgcgtgtcaagatgcagctgcgcagaccatctgaccgcgaggtcagc
gagcccatggacttccagtacctgccctcagacccggatgagcaccggctgatggagaag
cgcaagagaactgaaggaatgctgcataatctcaagctgagcagtatcatcacagggtcc
tcgatgtctgctgaaagacggccattccctacggctaaacgaactctacctgtctccaaa
cagccagtggcagccagtgcaccagccagtgtaccagcagtgtccgccgctcctccactg
aagcctccacccacctcctttttctctccgccccccggtcagctcttcacccagcaaaag
atggagccctcacccttgccggcatcctcctcagacatctggaagtatctgcaggccatg
tcagtggacagccagcccaaagcggtgccggtgctgccctttcccagtggaaccgtttcc
accggtagggatgcaaggctgataacagcagccaggggagagaatactgtcctgcacccg
tacacactgcattacacacacctcacacacgtgctcttattagtgtaa

DBGET integrated database retrieval system