KEGG   Danio rerio (zebrafish): 415099Help
Entry
415099            CDS       T01004                                 

Gene name
rela, nfkb3, p65
Definition
v-rel reticuloendotheliosis viral oncogene homolog A
Orthology
K04735  
transcription factor p65
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Apoptosis
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Adipocytokine signaling pathway
Salmonella infection
Herpes simplex infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:dre04010]
Cellular Processes; Cell growth and death; Apoptosis [PATH:dre04210]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:dre04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:dre04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:dre04622]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:dre04623]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:dre04920]
Human Diseases; Infectious diseases; Salmonella infection [PATH:dre05132]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:dre05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
7
AA seq 455 aa AA seqDB search
MDGMFHQWGTSQVPQGPPHVEIIEQPKSRGMRFRYKCEGRSAGSIPGEKSNDTTKTHPAI
RVHNYSGPVRVRISLVTKNQPYKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQCVK
KKDVGEAVSCRLQTQNNPFKIPDAKIWEEEFDLNAVRLCFQVSITLSSGDLFPLEPVVSQ
PIYDNRAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRFFLDSWESKGSFSQ
ADVHRQVAIVFRTPPYCDTNLTEPLRVKMQLRRPSDREVSEPMDFQYLPSDPDEHRLMEK
RKRTEGMLHNLKLSSIITGSSMSAERRPFPTAKRTLPVSKQPVAASAPASVPAVSAAPPL
KPPPTSFFSPPPGQLFTQQKMEPSPLPASSSDIWKYLQAMSVDSQPKAVPVLPFPSGTVS
TGRDARLITAARGENTVLHPYTLHYTHLTHVLLLV
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggacggaatgtttcaccagtggggaacttcgcaggtgcctcaaggtcctccacatgtg
gagatcatcgagcagcctaaatctcgagggatgcgtttccgttataagtgtgagggtcga
tcggccggcagcatccctggagagaagagcaacgacaccacgaaaacgcaccccgccatt
agggttcacaactacagtgggccagtcagagtgcggatctccttggtaaccaagaatcag
ccgtataagccacacccacacgagctggtgggaaaagactgtaaacatggctactatgag
gcagatctgcaggagcgcaggatacacagtttccagaatctgggtattcagtgtgtgaag
aagaaggatgtgggagaagctgtttcctgcagactgcagacgcaaaacaacccattcaag
attcctgacgcaaagatctgggaggaggagttcgacctgaacgcggtgcgtctgtgtttc
caggtctccatcaccctgagcagcggagatctgttccctctggagcccgtcgtctctcag
ccgatatacgacaacagagctcctaacactgctgagctgaagatctgccgtgtcaataga
aactccggcagctgtcgaggaggagacgagattttcctgctgtgtgataaagtacagaaa
gaggacattgaggtgcgcttcttcctggactcgtgggagagtaagggctcgttctctcag
gctgatgtgcaccggcaggtggcgatagtgttccgcacgccgccctactgcgacactaac
ctgaccgagccgctgcgtgtcaagatgcagctgcgcagaccatctgaccgcgaggtcagc
gagcccatggacttccagtacctgccctcagacccggatgagcaccggctgatggagaag
cgcaagagaactgaaggaatgctgcataatctcaagctgagcagtatcatcacagggtcc
tcgatgtctgctgaaagacggccattccctacggctaaacgaactctacctgtctccaaa
cagccagtggcagccagtgcaccagccagtgtaccagcagtgtccgccgctcctccactg
aagcctccacccacctcctttttctctccgccccccggtcagctcttcacccagcaaaag
atggagccctcacccttgccggcatcctcctcagacatctggaagtatctgcaggccatg
tcagtggacagccagcccaaagcggtgccggtgctgccctttcccagtggaaccgtttcc
accggtagggatgcaaggctgataacagcagccaggggagagaatactgtcctgcacccg
tacacactgcattacacacacctcacacacgtgctcttattagtgtaa

DBGET integrated database retrieval system