KEGG   Danio rerio (zebrafish): 415151Help
Entry
415151            CDS       T01004                                 

Gene name
rac2, zgc:86686
Definition
ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
Orthology
K07860  
Ras-related C3 botulinum toxin substrate 2
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Wnt signaling pathway
VEGF signaling pathway
Focal adhesion
Adherens junction
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:dre04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:dre04310]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:dre04370]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:dre04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:dre04510]
Cellular Processes; Cell communication; Adherens junction [PATH:dre04520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
3
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR
DEKETIEKLKEKKLAPITYPQGLALAKEIDAVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTKVKKKGCVML
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaataaagtgtgtggtggtcggagatggagctgtgggaaagacctgtcttctc
atcagctacactaccaatgcgttccccggggagtacattcccacagtgtttgataactac
tctgcaaatgtaatggtggatagcaaaccagtcaacctgggactctgggatacagccgga
caggaagattatgacagactgcggccactctcctacccgcagacggatgtgtttcttatc
tgtttctctttggtgagcccagcatcattcgaaaatgtcagagccaagtggtacccagag
gtgaggcatcactgcccttccactccaattatcctggttggcaccaagcttgacttgaga
gatgagaaggagaccatcgagaagctgaaggagaagaaactggcaccgatcacttaccca
cagggtctcgcattggccaaagaaatagatgcagtaaaatacctggagtgttcggccctc
actcagagagggctaaaaacagtgtttgatgaggcgattcgcgctgtgctctgcccacag
cccaccaaggtcaagaagaagggctgcgtgatgctctaa

DBGET integrated database retrieval system