KEGG   Danio rerio (zebrafish): 415151Help
Entry
415151            CDS       T01004                                 

Gene name
rac2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2
  KO
K07860  
Ras-related C3 botulinum toxin substrate 2
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Wnt signaling pathway
VEGF signaling pathway
Focal adhesion
Adherens junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    415151 (rac2)
   04310 Wnt signaling pathway
    415151 (rac2)
   04370 VEGF signaling pathway
    415151 (rac2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    415151 (rac2)
   04520 Adherens junction
    415151 (rac2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    415151 (rac2)
GTP-binding proteins [BR:dre04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    415151 (rac2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
3
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR
DEKETIEKLKEKKLAPITYPQGLALAKEIDAVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTKVKKKGCVML
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaataaagtgtgtggtggtcggagatggagctgtgggaaagacctgtcttctc
atcagctacactaccaatgcgttccccggggagtacattcccacagtgtttgataactac
tctgcaaatgtaatggtggatagcaaaccagtcaacctgggactctgggatacagccgga
caggaagattatgacagactgcggccactctcctacccgcagacggatgtgtttcttatc
tgtttctctttggtgagcccagcatcattcgaaaatgtcagagccaagtggtacccagag
gtgaggcatcactgcccttccactccaattatcctggttggcaccaagcttgacttgaga
gatgagaaggagaccatcgagaagctgaaggagaagaaactggcaccgatcacttaccca
cagggtctcgcattggccaaagaaatagatgcagtaaaatacctggagtgttcggccctc
actcagagagggctaaaaacagtgtttgatgaggcgattcgcgctgtgctctgcccacag
cccaccaaggtcaagaagaagggctgcgtgatgctctaa

DBGET integrated database retrieval system