KEGG   Danio rerio (zebrafish): 415151Help
Entry
415151            CDS       T01004                                 

Gene name
rac2, zgc:86686
Definition
ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
Orthology
K07860  
Ras-related C3 botulinum toxin substrate 2
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Wnt signaling pathway
VEGF signaling pathway
Focal adhesion
Adherens junction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    415151 (rac2)
   04310 Wnt signaling pathway
    415151 (rac2)
   04370 VEGF signaling pathway
    415151 (rac2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    415151 (rac2)
  Cell communication
   04510 Focal adhesion
    415151 (rac2)
   04520 Adherens junction
    415151 (rac2)
GTP-binding proteins [BR:dre04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    415151 (rac2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
3
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR
DEKETIEKLKEKKLAPITYPQGLALAKEIDAVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTKVKKKGCVML
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaataaagtgtgtggtggtcggagatggagctgtgggaaagacctgtcttctc
atcagctacactaccaatgcgttccccggggagtacattcccacagtgtttgataactac
tctgcaaatgtaatggtggatagcaaaccagtcaacctgggactctgggatacagccgga
caggaagattatgacagactgcggccactctcctacccgcagacggatgtgtttcttatc
tgtttctctttggtgagcccagcatcattcgaaaatgtcagagccaagtggtacccagag
gtgaggcatcactgcccttccactccaattatcctggttggcaccaagcttgacttgaga
gatgagaaggagaccatcgagaagctgaaggagaagaaactggcaccgatcacttaccca
cagggtctcgcattggccaaagaaatagatgcagtaaaatacctggagtgttcggccctc
actcagagagggctaaaaacagtgtttgatgaggcgattcgcgctgtgctctgcccacag
cccaccaaggtcaagaagaagggctgcgtgatgctctaa

DBGET integrated database retrieval system