KEGG   Danio rerio (zebrafish): 415158Help
Entry
415158            CDS       T01004                                 

Gene name
cycsb, cyc, wu:fk52b01, zgc:86706
Definition
cytochrome c, somatic b
Orthology
K08738  
cytochrome c
Organism
dre  Danio rerio (zebrafish)
Pathway
Sulfur metabolism
p53 signaling pathway
Apoptosis
Herpes simplex infection
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:dre00920]
Cellular Processes; Cell growth and death; Apoptosis [PATH:dre04210]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:dre04115]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:dre05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
6
AA seq 104 aa AA seqDB search
MGDVEKGKKVFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGFSYTDANKSKGIVW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKSATS
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgttgaaaagggcaagaaggtgttcgtccagaagtgcgcccagtgccacacc
gttgaaaatggaggcaagcataaagtggggccaaatctctggggtcttttcggtcgcaag
actggtcaggctgagggattttcctatacagatgctaacaagagcaaaggcattgtctgg
ggtgaagataccttgatggaatatttggagaacccaaagaaatacattccaggcacaaag
atgatctttgccgggatcaagaagaagggcgagagagcagatcttattgcatacttaaag
tcggccacatcataa

DBGET integrated database retrieval system