KEGG   Danio rerio (zebrafish): 415158Help
Entry
415158            CDS       T01004                                 

Gene name
cycsb, cyc, wu:fk52b01, zgc:86706
Definition
cytochrome c, somatic b
Orthology
K08738  
cytochrome c
Organism
dre  Danio rerio (zebrafish)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    415158 (cycsb)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    415158 (cycsb)
   04115 p53 signaling pathway
    415158 (cycsb)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    415158 (cycsb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
6
AA seq 104 aa AA seqDB search
MGDVEKGKKVFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGFSYTDANKSKGIVW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKSATS
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgttgaaaagggcaagaaggtgttcgtccagaagtgcgcccagtgccacacc
gttgaaaatggaggcaagcataaagtggggccaaatctctggggtcttttcggtcgcaag
actggtcaggctgagggattttcctatacagatgctaacaagagcaaaggcattgtctgg
ggtgaagataccttgatggaatatttggagaacccaaagaaatacattccaggcacaaag
atgatctttgccgggatcaagaagaagggcgagagagcagatcttattgcatacttaaag
tcggccacatcataa

DBGET integrated database retrieval system