KEGG   Danio rerio (zebrafish): 415161Help
Entry
415161            CDS       T01004                                 

Gene name
sirt6, zgc:86729
Definition
sirtuin 6 (EC:2.4.2.31)
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     415161 (sirt6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
2
AA seq 354 aa AA seqDB search
MSVNYAAGLSPYADKGICGLPETFDSPEELKTKVETLAQWIRESQYMVVHSGAGISTSTG
IPDFRGPNGVWTMEERGETPHFNTTFEDARPSLTHMALLQMQRTGHLKYLISQNVDGLHV
RSGFPRDRLSELHGNMFVEECEKCGKQYVRDTVVGVMGLKPTGRYCDVMRSRGLRSCRGK
LISSILDWEDSLPDRDLNRADEASRRADLALTLGTSLQIKPSGDLPLLTKRTGGKLVIVN
LQPTKHDKHAHLRIYGYVDDVMGQLMKLLGLDVPEWAGPTLCEDSGGDLDILPYGAWKKE
VKIELKIEESNHTVSKKRKRKEQHAEEGYKNGVKVEEEMKEEGKESDSHVHTHT
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgccgcaggactgtctccatacgcggataaaggtatctgcggtctg
ccggagacattcgacagtcctgaggagctgaagactaaagtggagactctggcccagtgg
atcagagagtctcagtacatggtggttcattcaggagctggaatcagtacgtctacaggc
atacccgacttcagaggtcctaatggtgtgtggacgatggaagagagaggggagactcca
cactttaacaccacgtttgaggacgctcgacccagcctgactcacatggctctgctgcag
atgcagaggacaggacacctcaaatacctcatcagccaaaacgtcgatggccttcacgta
cgctctggcttccccagggatcgattgtcggagctgcatgggaacatgtttgttgaagaa
tgtgagaagtgtggcaagcaatacgttcgggacacggtggtcggagtgatgggactgaag
ccgactggaagatactgcgacgtcatgcgctccagaggactacgatcctgcagagggaag
ctgatcagctctatattggactgggaggactctctgcccgacagagacctgaacagagct
gatgaggcgagcaggcgagctgatctggctttgacactggggacgtctcttcagattaaa
cccagcggagatctgcctcttctaaccaaacgaacaggaggaaaactggttatagttaac
cttcagcctaccaaacatgacaaacacgctcacctgcgtatatacggttacgtcgatgat
gtcatgggtcagctcatgaagctgctgggattggacgttccggagtgggccgggccaacc
ctctgcgaagactcgggtggagatctggacatcctgccatacggagcctggaagaaggaa
gtgaagatcgagctgaagatcgaggagagtaatcacaccgtctcaaagaaacgcaagagg
aaagagcagcacgctgaggagggctacaagaatggtgttaaagtagaagaagagatgaaa
gaagagggaaaggaaagtgactctcacgtacacacacacacttga

DBGET integrated database retrieval system