KEGG   Danio rerio (zebrafish): 415207Help
Entry
415207            CDS       T01004                                 

Gene name
rbks, zgc:86813
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dre  Danio rerio (zebrafish)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    415207 (rbks)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     415207 (rbks)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
17
AA seq 311 aa AA seqDB search
MAEDFSVVVVGSCMTDLVSQAPRFPKAGETIHGHRFFIGFGGKGANQCVQAARMGAKTAM
VCKVGRDVFGNDYIQNFKNNGISTAYVEQTEKAATGAASIIVNDTGENAIVIVAGANLLL
GQEELQRAQSAIINAKVLVCQLEISPDASLQALKMARENHVKTIFNPAPAIAYLDSDFYK
ASDVFCCNESEAEMLTGLSVTSVEDACQVGLELLNKGCASVIVTLGSQGCVVCQSTNKTP
KHIPTIEVTAADTTGAGDSFIGALAFYMAHYPAMPMEEMARRANLVAAVSVQTVGTQTSF
PFRKDLPTELF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagactttagtgttgtcgttgtgggctcttgtatgactgatttagtaagtcag
gcacctcgattccccaaggctggagagacgatacatggacacaggttctttattggcttt
ggtggaaaaggggccaatcaatgtgtccaagctgcacgaatgggggccaaaactgccatg
gtgtgcaaggttggcagagacgtttttgggaatgactacattcaaaacttcaaaaataat
ggcatatcgactgcctatgtagagcagactgaaaaggccgcgactggagccgcctctatc
attgtaaatgacacaggggaaaatgccatagtgattgttgctggtgctaatttgctcctg
gggcaagaggaactacaacgggcacagtctgcaataataaacgccaaggtgctggtctgc
cagctagaaatcagccctgatgcatcgctacaggccctaaaaatggctagagagaaccat
gtgaagactatttttaatccagctcctgctattgcgtacctggattctgatttctacaaa
gcatctgatgttttctgctgcaacgagtctgaggccgagatgttgacaggtctctccgtt
acctcagtggaagacgcttgtcaagttggcctggagctgttaaacaaaggttgtgcttca
gtgattgtcaccttggggtcacagggctgtgtggtgtgtcagtctacaaacaagacccct
aaacacattcccaccattgaggtcactgccgcggatactacgggtgcaggcgacagcttt
attggggctctggctttttacatggctcattatccagcaatgccaatggaagagatggcc
agaagagcaaaccttgtcgcagcggtgtctgtacaaactgtcggcactcaaacatctttt
ccatttcggaaggatctgccaactgaactattctga

DBGET integrated database retrieval system