KEGG   Danio rerio (zebrafish): 415216Help
Entry
415216            CDS       T01004                                 

Gene name
guk1a
Definition
(RefSeq) guanylate kinase isoform 2
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre01100  Metabolic pathways
Module
dre_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    415216 (guk1a)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     415216 (guk1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 RsgA_GTPase ABC_tran MMR_HSR1 RNA_helicase AAA_17 AAA_22 AAA_29 Zeta_toxin AAA_14 cobW NACHT NTPase_1 PBP-Tp47_c DUF2075 T2SSE AAA AAA_28 AAA_30 Mg_chelatase Viral_helicase1 ATPase_2 TsaE dNK AAA_5 AAA_24
Motif
Other DBs
NCBI-GeneID: 415216
NCBI-ProteinID: NP_001002126
ZFIN: ZDB-GENE-040625-130
Ensembl: ENSDARG00000030340
Position
2
AA seq 208 aa AA seqDB search
MRAHTTDKAMAGPRPVVMSGPSGAGKSTLLKKLLKEFNGVFGFSVSHTTRNPRPGEENGK
DYHFVSREVMQTSIAKGEFIESAEFSGNMYGTSKAAVQAVQAQNLICILDIDMQGVKNIK
KTDLNPIYVSVQAPSMDILEKRLRDRKTESEESLQKRLHAAKVDVEISKEPGLFDVVIIN
DDLEAAYGKLKDVLLEEIQKVRDVNKSS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagagctcacaccacggacaaagcgatggctggaccgaggcctgtggtgatgagtgga
ccgtccggggctggaaaaagcactctgttgaagaaactgctcaaggagttcaacggtgtt
tttggattcagcgtctctcatacaacacgaaacccacgtccaggagaagagaacggcaaa
gattatcattttgttagcagggaggtcatgcagacgagcatagcaaaaggggaattcatt
gaaagtgcagagttttcagggaacatgtacgggacgagtaaagcagccgtacaggcagtt
caggcccaaaatttgatttgcattttggacattgacatgcagggagtgaagaacatcaag
aagaccgatctcaaccccatctatgtgtccgtccaggccccgtcaatggacatactggaa
aagcgattgcgggacagaaagactgaatcggaggaaagtctacaaaaacgtttacatgct
gccaaagttgacgtggaaataagtaaagagcctggtttatttgatgtggtcattatcaat
gatgatcttgaagcagcgtatggaaaattaaaagacgttcttcttgaggagatccaaaag
gtccgagatgtcaacaaatccagttaa

DBGET integrated database retrieval system