KEGG   Danio rerio (zebrafish): 436604Help
Entry
436604            CDS       T01004                                 

Gene name
uox, cb745, wu:fd44h08, zgc:92414
Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dre  Danio rerio (zebrafish)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Module
Purine degradation, xanthine => urea
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dre00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:dre00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
11
AA seq 298 aa AA seqDB search
MATTSNQNVEFVRTGYGKNMVKVLHIRREGNHHHIIELIANVQLTLKTRKDYLTGDNSDI
IPTDTVKNTVHALAKLKGIKSIESFALDICEHFLTAFNHVTRVKVNIDEVPWKRLEKNGV
EHNHAFIHCPEALRFCEAEQYLSKTPVVHSGLKDMKVLKTTQTGFEGFLRDRFTTLTDAK
DRFFCTSVYARWRYNTINVAFDAAWKAVKDTVIQKFAGPYDRGEYSPSVQKTLYDTQLLV
LDRIPEVEEIEIIMPNQHYFVIDMTKIGLSNKDEVYLPLDNPSGNITGTVCRKPRARM
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggccactacctcaaatcagaatgtggagttcgtgagaaccggctatggaaagaatatg
gttaaagttcttcacatccggcgtgaagggaaccatcaccatattattgagctgattgca
aacgttcagttaacccttaagacccgcaaagactatctaacaggagacaactctgacatc
atccccactgacaccgtcaaaaacaccgtccacgctcttgccaaactaaaagggattaaa
agcattgagagctttgcactggatatctgtgaacatttcctcacagcgttcaatcatgtc
acaagagtgaaggtcaacattgatgaagttccctggaaaagactggaaaagaatggagtt
gagcacaaccatgctttcatccactgccctgaggctttgcgcttctgtgaagccgaacaa
tatctgagtaagactccagtggttcacagtggtctaaaagacatgaaggtattgaagact
acacaaactggatttgagggctttttgcgagatcgtttcaccactctgactgatgcaaaa
gacagattcttctgtacttctgtctatgcaagatggcgctacaacacgataaatgtggca
tttgacgctgcatggaaagctgttaaggacaccgtcattcaaaagtttgcaggaccctac
gatcgtggggagtactctccttctgttcagaaaactctctatgatacacaactcctggta
cttgacagaattccagaggttgaggaaattgagataattatgccgaaccagcattatttt
gtcatcgacatgacaaaaataggactctcgaacaaggatgaggtttatcttcctcttgat
aatccatcaggaaacatcacaggcactgtgtgcagaaaaccacgagccagaatgtga

DBGET integrated database retrieval system