KEGG   Danio rerio (zebrafish): 436617Help
Entry
436617            CDS       T01004                                 

Gene name
rxrgb, zgc:92183
Definition
retinoid X receptor, gamma b
Orthology
K08526  
retinoid X receptor gamma
Organism
dre  Danio rerio (zebrafish)
Pathway
PPAR signaling pathway
Adipocytokine signaling pathway
Class
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:dre04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:dre03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 452 aa AA seqDB search
MDTHDTYLHLHSSPLNSSPSQPPVMSSMVGHPSVISSSRPLPSPMSTLGSSMNGLPSPYS
VITPSLSSPSISLPSTPSMGFNTLNSPQMNSLSMNGNEDIKPPPGLAPLGNMSSYQCTSP
GSLSKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYTCRDIKECLIDKRQRNRC
QYCRYQKCLAMGMKREAVQEERQRGKEKSDTEVETTSRFNEDMPVDKILDAELSVEPKTE
TYTESSPSNSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLPLDDQVILLRAGWNELLI
ASFSHRSITVKDGILLGTGLHVHRSSAHSAGVGSIFNRVLTELVSKMKDMQMDKTELGCL
RAIVLFNPDAKGLSNSLEVEALREKVYASLETYTKQKYPDQPGRFAKLLLRLPALRSIGL
KCLEHLFFFKLIGDTPIDTFLMEMLEAPHQIT
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggatactcacgacacatatttacatctccactctagtcctcttaactcgtccccctct
cagccgccggtcatgagctctatggtgggtcatccgtccgtcatcagctcctctcgcccc
ctgccgtcccccatgagcactctgggctcctctatgaatggcctgccctcaccctactcc
gtcatcaccccgtctctcagttcgccctccatttccctgccctccacacccagcatgggc
tttaacaccctcaacagcccacagatgaactctctcagtatgaatggcaatgaagacatc
aagcccccgccaggattggcaccgctgggcaacatgagcagctaccagtgcaccagccct
ggatctctgtccaaacacatctgtgccatctgtggagaccgatcttcagggaagcattat
ggtgtttatagttgtgaaggctgcaagggcttctttaagaggaccattcgaaaagacctg
acgtacacatgtcgagacattaaagagtgcctgatcgacaagcgccagcgcaaccgctgc
caatactgccgctaccagaagtgcttggccatgggcatgaagcgcgaagcggttcaggaa
gagaggcagcgagggaaagagaaaagtgatactgaggtggaaacaacaagcaggtttaat
gaagacatgcctgtggataaaatcctggatgcagaactgtcagtcgaacccaagactgag
acgtacacagagagcagccccagcaactcaacaaatgacccagtcactaatatctgccat
gcagcggataagcagttgtttactctggtggagtgggccaagagaatacctcatttctct
gatctgcctctggatgatcaagtaatccttcttcgagcaggatggaacgagctgctcatt
gcttcattctctcatcgctccatcacagtgaaagatggcatcctgctaggcacagggctt
catgtccacaggagcagtgctcacagtgcaggagttggctccattttcaacagggtactg
accgaactggtgtctaaaatgaaggacatgcagatggataagacagaactaggctgcctt
agggccatcgtcctcttcaaccctgacgccaaaggcttgtcaaactcactggaggtggag
gcactgagggagaaggtttacgcctcgctggagacctacactaaacagaaataccccgac
cagcctggcaggtttgctaagctgctgctgcgtcttcctgcgcttcgctccatcggcctc
aagtgtctggagcacctgtttttctttaagctgattggagacacacctatagacactttc
ctcatggagatgctggaagcgccacatcagatcacgtga

DBGET integrated database retrieval system