KEGG   Danio rerio (zebrafish): 436622Help
Entry
436622            CDS       T01004                                 

Definition
zgc:92162 (EC:3.1.1.4)
Orthology
K01047  
secretory phospholipase A2 [EC:3.1.1.4]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Vascular smooth muscle contraction
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dre00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:dre00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:dre00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:dre00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:dre00592]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:dre04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
3
AA seq 153 aa AA seqDB search
MTSLYHTFLLFTVSMASLQPQRSLRSKRGLLELAGVIKCSTGRSALSYVMYGCYCGLGGQ
GWPRDRADWCCHKHDCCYGDAEFAGCQTKTDRYHWTCDDEQADCDSLNDRCAKILCRCDR
EAARCLRKAPFNPKYALWPDFLCGCVHPTCNIY
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgctgtaccacacattcctgctcttcacagtcagtatggcgtcactgcagccg
cagcgctctttacggagtaaaaggggtctgctggagctggccggagtcatcaagtgcagc
actggccgctcagctctgtcctatgtgatgtacggatgttactgtggtctggggggtcaa
ggctggcccagagacagggcggactggtgctgtcacaaacacgactgctgttatggggat
gccgaattcgcaggatgccaaaccaaaacggaccgttatcattggacgtgtgacgatgag
caggccgactgtgactcgcttaatgatagatgtgcgaaaatcctgtgccgatgtgaccgt
gaagcagccagatgcctcagaaaggccccgttcaacccaaaatacgctctgtggccggat
ttcctctgcggatgcgttcatcctacctgcaacatttactaa

DBGET integrated database retrieval system