KEGG   Danio rerio (zebrafish): 436622Help
Entry
436622            CDS       T01004                                 

Gene name
zgc:92162
Definition
(RefSeq) group 10 secretory phospholipase A2
  KO
K01047  
secretory phospholipase A2 [EC:3.1.1.4]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    436622 (zgc:92162)
   00565 Ether lipid metabolism
    436622 (zgc:92162)
   00590 Arachidonic acid metabolism
    436622 (zgc:92162)
   00591 Linoleic acid metabolism
    436622 (zgc:92162)
   00592 alpha-Linolenic acid metabolism
    436622 (zgc:92162)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    436622 (zgc:92162)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     436622 (zgc:92162)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    436622 (zgc:92162)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 153 aa AA seqDB search
MTSLYHTFLLFTVSMASLQPQRSLRSKRGLLELAGVIKCSTGRSALSYVMYGCYCGLGGQ
GWPRDRADWCCHKHDCCYGDAEFAGCQTKTDRYHWTCDDEQADCDSLNDRCAKILCRCDR
EAARCLRKAPFNPKYALWPDFLCGCVHPTCNIY
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgctgtaccacacattcctgctcttcacagtcagtatggcgtcactgcagccg
cagcgctctttacggagtaaaaggggtctgctggagctggccggagtcatcaagtgcagc
actggccgctcagctctgtcctatgtgatgtacggatgttactgtggtctggggggtcaa
ggctggcccagagacagggcggactggtgctgtcacaaacacgactgctgttatggggat
gccgaattcgcaggatgccaaaccaaaacggaccgttatcattggacgtgtgacgatgag
caggccgactgtgactcgcttaatgatagatgtgcgaaaatcctgtgccgatgtgaccgt
gaagcagccagatgcctcagaaaggccccgttcaacccaaaatacgctctgtggccggat
ttcctctgcggatgcgttcatcctacctgcaacatttactaa

DBGET integrated database retrieval system