KEGG   Danio rerio (zebrafish): 436627Help
Entry
436627            CDS       T01004                                 

Gene name
bpnt1, zgc:92144
Definition
bisphosphate nucleotidase 1 (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dre  Danio rerio (zebrafish)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    436627 (bpnt1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     436627 (bpnt1)
Transfer RNA biogenesis [BR:dre03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    436627 (bpnt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 309 aa AA seqDB search
MASNPAVLMRLVASAHAVAEKAGTIVRRVLKSGELGIVEKTGANDLQTLADRLVQKSICA
SLSKSFPKLTIIGEEDLPAETVEDDLIENGQNSLILEKSCPDQYASLKEEELVVWVDPLD
GTKEYTEGLLDHVTVLIGIAHAGTAIAGVINQPFYNYQAGAGATLGRTLWGVLGLGAFGF
QLKEVPDGKRIITTTRSHSNKLVIDTVQAMEPHDVIRVGGAGNKIIQLVEGTASAYVFAS
LGCKKWDTCAPEAILHAVGGKLTDMHGNTYKYDANVKHMNSAGVLATLRNHEYYLSRVPQ
AVQQALPTD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaatcctgcagtgttgatgcggttggtggcttcggctcacgctgtggcagaa
aaggctggaacaattgtccgaagagtgctcaaaagtggagagctcggtattgttgaaaag
acaggagccaatgatctacagacactggccgacaggcttgttcagaagagtatttgtgca
tccttgtccaaaagcttccctaaactcactattattggggaagaggacttacctgctgag
actgtcgaagatgacctgatagagaacggccagaacagcttaatcctagaaaagtcctgt
ccagatcagtatgcaagcctgaaagaggaagagctagttgtgtgggtcgaccctctcgat
ggaactaaagagtatacggaagggctcttggatcatgtgacagtcctcataggtattgct
catgcaggaacagccattgctggagtcatcaatcaacctttctacaactaccaggcgggg
gctggtgctactctaggccggacattatggggagtgttgggtttgggtgcattcgggttt
caactcaaggaggtcccagatggtaaaagaatcatcacgaccacacggtcgcatagtaat
aaacttgtgatcgacacagttcaagcaatggagcctcatgatgtcatcagagtgggcgga
gctggaaataagatcatccagctggtggagggaacggcttccgcttatgtgtttgccagt
ctaggatgtaaaaagtgggacacttgtgcacctgaggctattctgcacgcagttggaggt
aaactgacagacatgcatgggaatacatacaaatatgatgccaatgtgaagcacatgaat
tctgctggagttctggcaacattgagaaatcatgagtactatttaagcagagtgccgcag
gccgtccaacaggctcttcccacagactga

DBGET integrated database retrieval system