KEGG   Danio rerio (zebrafish): 436638Help
Entry
436638            CDS       T01004                                 

Definition
zgc:92510 (EC:2.3.1.48)
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     436638
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 541 aa AA seqDB search
MADHSVEITEGCRLPVLRRNQENEDEWPLAEILSVKDISGRKLYYVHYVDFNKRLDEWVT
PDRLDIKKLQFPKKEAKTPMKNGLSGSRPSSPERDVKKSLDLHVQSASAPSRGKTVPTPK
RKAESVSLATQVTAATPVPSLPASTEASQAALYTAIRDASFNIKSREEHEPLTSLTTNGT
TSIQRHLIPPQPGRKRKNCGGTDEMVKVFQNNSPRCSTVYLLPGEDSQDSSDGIPSAPRM
TGSLVSDRSHDDIVTRMKNIGCIELGRHRLKPWYFSPYPQELTSLPIIYLCEFCLKYLKS
LKCLQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKAYSQNLCLLAKCFLDHKTLYYD
TDPFLFYVMTEYDPKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYEL
SKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMDLKSENGERPQITINEISEITSIKK
EDVISTLQYLNLINYYKGQYILTLSEDIVEGHECAMQKRHLRIDPKCLHFTPKDWSKRGK
W
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccactctgttgaaataactgagggctgtcgacttccagtattgcggagaaat
caagaaaacgaagacgaatggcctttggctgaaatcttaagtgtcaaagacatctctggg
aggaagctctactatgtccactatgttgacttcaataagcggctggacgaatgggtcact
ccagaccggctggacattaagaagctccaatttcccaaaaaggaggcaaagacccccatg
aagaatggcctgtctgggtctcgtccgagctcaccagaaagagacgtgaagaagagtcta
gatcttcatgttcagtctgcttcggctccttcaagaggcaaaaccgtccccacaccgaaa
aggaaagcggagtcagtctctttagccacacaggtgactgcagcgactccagtgccttca
cttccagcttctacagaggccagtcaggcggcactctatacagcaatcagagatgcatcc
ttcaacattaaatccagagaagaacatgaaccgctcacctctctaacaacaaatggcaca
acatccatccagcgccatcttattcctcctcaacctgggagaaaaagaaagaattgtgga
ggcacagatgagatggtaaaggtgttccagaataacagtccccgctgctccaccgtctat
ttgctgccaggagaggactcgcaggacagttcagatggaatcccttctgccccacgcatg
actgggagcttggtgtccgaccgcagccatgatgacatcgtgactcggatgaagaacata
ggctgtatagagctgggccgacacagactgaagccttggtacttctctccatacccacag
gagctcacctctctgcccattatctacctttgtgaattctgtctcaaatacctcaagagc
ctcaaatgtcttcagaggcacctgacaaaatgcaaccttcggcatcctccaggaaatgag
atctaccgcaaaggaaccatctcctttttcgaaatagatggcagaaaaaacaaggcatat
tcccaaaatttgtgtttactggctaaatgcttcctggaccacaagaccctgtactacgac
acagaccctttcctcttctatgttatgacagagtacgacccaaagggtttccatattgtt
ggctacttctcaaaggagaaagaatcaacagaggactataatgtggcctgtatcctgacg
ttaccaccttaccagagaagaggctatggcaaactgctcattgagttcagttatgagctc
tcaaaggtggaaggaaagacgggcaccccagagaaacccttgtctgatttgggactgctc
tcctaccgctcgtactggtcccagaccattctggagatactcatggacctcaaatcagag
aatggagaacgaccacagatcaccatcaatgaaatcagtgagattacaagcatcaagaaa
gaagatgtgatatccacccttcagtacctcaacctcatcaattattataagggtcaatac
atcctcaccttgtccgaggacatagtggaaggtcacgagtgtgcaatgcagaaacgccat
ctccgcattgatcccaaatgcttgcatttcactcctaaagactggagcaagaggggcaag
tggtga

DBGET integrated database retrieval system