KEGG   Danio rerio (zebrafish): 436646Help
Entry
436646            CDS       T01004                                 

Gene name
galm, zgc:92501
Definition
galactose mutarotase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    436646 (galm)
   00052 Galactose metabolism
    436646 (galm)
Enzymes [BR:dre01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     436646 (galm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
13
AA seq 342 aa AA seqDB search
MTEVHKEEFGTALGPVERWILRSASVSVEIISLGCVIKSIKTADRSGQSADIVLGFDDIE
GYFSNPRYFGAVVGRVANRISKGRFVIDEKEYKLAINNGPNALHGGLKGFDKAVWSTEAV
DNGVKLSHSSPDGDEGYPGNLKVSVTYTLEKSTLSVLYHAQTDHTTPINLTNHSYFNLAG
EGTPDIYDHEVTISAESYLPVDDTVIPTGEVKPVEKTPFDLRKPVILGFRLKELSGPGFD
HNFCLYLPGEPPLERKCARVVHPGTGRVLEVSTTQPGVQFYTSNFLDGSVKGKGGAAYSK
HSAFCLETQNWPDAVNQPHFPDALLRPGETYSHTTRFTFSVV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagtgcataaagaggagttcggcactgctctgggtccagtggagagatggatc
ctgcggtcagcgagtgtcagtgtggagatcatttctctgggctgcgtgataaagtccatc
aaaacagcagatcgcagcggtcaaagtgcggatatagtgttaggattcgatgatatagaa
ggttatttctctaatcctcgctactttggagctgttgtaggccgggttgcaaaccgcata
tccaagggccgttttgtgatcgatgagaaggaatataaactagctataaacaatggaccc
aatgctctccatggaggactgaagggctttgacaaggctgtgtggagcacagaggcagtg
gataatggagtgaaactgagtcacagtagtccagatggtgatgaaggctatcctggaaac
ttaaaggtttctgtcacctacacgctagagaagagcacactgagcgtgctgtaccatgca
cagactgaccataccacaccaatcaacctcaccaaccattcatacttcaacctggctgga
gaggggacgccagatatttatgatcacgaggtgactatctcagccgagtcctacctgcct
gttgatgatacagtgatacccacaggggaggttaaacctgtggagaagactccgtttgac
ctgagaaagcctgtcattcttggctttagactgaaagaactgtctggtccaggctttgat
cacaacttctgtttgtatttacctggtgaacctccactggagcgaaaatgtgcacgagtg
gtgcatcctgggactggtcgtgttctggaggtgagcactacccagcctggggttcagttc
tacacctccaactttctggatgggtcggtgaaaggcaaaggtggagctgcttactccaag
cacagtgccttctgtttggagacccaaaactggcctgatgctgtcaaccagccccatttt
ccagatgctctgctgaggccaggagagacatactcgcatacaacacgcttcacattctct
gtggtgtaa

DBGET integrated database retrieval system