KEGG   Danio rerio (zebrafish): 436729Help
Entry
436729            CDS       T01004                                 

Gene name
setd7
Definition
(RefSeq) histone-lysine N-methyltransferase SETD7
  KO
K11431  histone-lysine N-methyltransferase SETD7 [EC:2.1.1.43]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00310  Lysine degradation
dre04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    436729 (setd7)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    436729 (setd7)
Enzymes [BR:dre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     436729 (setd7)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     436729 (setd7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MORN SET
Motif
Other DBs
NCBI-GeneID: 436729
NCBI-ProteinID: NP_001002456
ZFIN: ZDB-GENE-040718-156
Ensembl: ENSDARG00000038858
Vega: OTTDARG00000021328
UniProt: Q6DHG0
Position
14
AA seq 373 aa AA seqDB search
MDSDDDNMEEVVEGPLDEDDQPHGFCTVTYSSSDRFEGHFVHGEKNGKGKFFFFDGSTLE
GFYVDDALQGQGVYTYEDGGALHGFYVDGELNGPAQEFNSDGQLVFRGRYKDNIRYGMCW
VYYPDGACVVGEVNEEGEMTGKAVAYVYPDGRTALYGSFVDGELIEARLATLTTQENGRP
HFTVDPDSPIYCYDKSTSSCIAGHKLLPDPYESQRVYVGQSLISGAGEGLFAQTEAEANT
VMAFYNGVRITHTEVDSRDWSMNGNTISLDEDTVIDVPAPFNMTENYCGSLGHKANHSFS
PNCKYDQYVHPRFGQIKCIRTIRAVEKDEELTVAYGYDHEPSGKSGPEAPEWYTKQFLEF
QQRESGKGADETC
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggacagcgatgatgacaacatggaagaagtggtggaaggaccactggatgaggatgac
cagcctcatggtttctgcactgtgacctactcctccagtgacagatttgaaggacatttt
gttcatggcgagaagaatggaaaaggaaaattcttcttttttgatggcagtacactggag
ggtttctatgtggacgatgctttgcagggtcagggtgtttacacatacgaggatggagga
gcattacatgggttctacgtagatggcgagctaaatggacctgctcaagagttcaattca
gacggtcaactggtcttcaggggacgatacaaggacaacattcgctatggcatgtgctgg
gtctactatccggatggagcctgtgttgtgggagaagtgaatgaagaaggagaaatgact
ggaaaggcagtggcttatgtgtaccctgatggccgtacggctctgtatggctcttttgtt
gacggagagctgatagaggctcggcttgcgactcttacaacccaagagaacggccggccg
cacttcactgttgatccagatagtcctatttactgctatgataaatccacttcatcctgt
atcgctggtcataaactgctgcctgacccctacgaaagtcaacgtgtgtatgtgggacag
tcgcttatttccggagctggagaagggctttttgcacaaacggaggctgaggctaacact
gtgatggctttttataatggtgtccgcattacacacactgaggtggacagtcgtgattgg
tccatgaatgggaacaccatttcattggacgaggacactgtgattgacgttcctgcacct
tttaatatgacagagaattattgtggatctcttggtcacaaggccaatcactccttctct
cccaactgcaaatacgaccagtatgtccatcctcgttttggccaaataaaatgcatccga
acaatccgagctgtggagaaggacgaggaactcacagttgcttatggttatgatcatgag
ccttcgggaaagtctggtccagaggcaccagaatggtacacgaagcagtttctggagttt
cagcagagggagtcaggaaaaggggcagacgagacctgctaa

DBGET integrated database retrieval system