KEGG   Danio rerio (zebrafish): 436920Help
Entry
436920            CDS       T01004                                 

Gene name
egr3, zgc:92020
Definition
early growth response 3
Orthology
K12497  
early growth response protein 3
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
8
AA seq 422 aa AA seqDB search
MTGKLADKIPITMSSLINTIPDSLYPEEDIPTSMNIFTNPDSISHYSQMNTDNIMDLGMG
GEKGSGEIQYGSGSFQSGRSGQTVTYLGKFAFDTPPSGSIGGSGWCPDNNIISLVSAGIL
GVSPSPGNITTQTSSSSGSMGGQSSDMEQVYAPPLPAYSTCGEIYPEQVTFHHSPATSSS
LPYPSSDYHTTSKPGMDGSLFSMIPDYNLFHHQGDVGVMEHKPFQTMDPIRVNPPPITPL
ETIRAFKDKQQIHPGFLGGQQHVSQHHQPSQTLALKPIRPRKYPNRPSKTPVHERPHACP
AENCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFC
GRKFARSDERKRHAKVHLKQKDKKPTDKGSSAGAGGNHTSPPSSCGSAGPSSTNIMTVTT
CA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgacaggtaaactagcggacaagatccctattaccatgagcagtttaatcaacaccata
cctgacagtctctacccagaagaagacatcccaacttctatgaacattttcacaaacccg
gactccatttcgcactactcgcagatgaatacagataatatcatggacttggggatgggc
ggcgagaagggcagcggagaaattcagtacggctccggcagcttccagtctgggcgaagt
gggcagaccgtcacctacctgggcaagtttgcattcgacacccctccttcaggcagcatc
ggcggctccggctggtgtcccgacaacaacatcataagcctggtgagtgcaggcatccta
ggggtgtccccttcacctggaaacatcaccacccagacgtcttcatccagcggcagcatg
ggtggccagtcttcagacatggagcaagtatacgcaccacccctacctgcctactccacc
tgtggagaaatatacccagagcaggtgacgttccaccacagtccggccacgtcctcatcc
ttgccctacccgagctctgactaccacaccacctctaaaccaggcatggacggcagtctc
ttctccatgatcccagactacaacctcttccatcatcagggagacgtaggggtgatggag
cataaaccctttcaaaccatggaccctatcagggtgaacccgcctcccataactcccctc
gagaccattcgagcttttaaggataagcagcagattcatcccggcttcctcggtgggcaa
cagcacgtttcgcaacatcatcaaccctctcagacactagctctcaaacctatccgtcca
agaaagtatcccaacaggccgagcaaaactccagtgcacgagagaccacatgcctgtccg
gccgagaactgtgaccggcgtttttcgcgatccgatgagttgacgcggcacctgcgcatc
cacacaggacacaaacccttccagtgccgcatctgcatgcggtccttcagtcgcagtgac
catctcaccacacacatccgcacacacaccggcgagaagccgttctcttgcgaattctgt
ggacgcaagtttgcgcggagcgacgagcgaaagcggcacgccaaggtgcacctcaaacag
aaggacaagaaacccacggacaagggcagcagtgctggggcaggggggaaccacacttct
cctcccagctcctgtgggagcgcaggacccagcagtactaacatcatgaccgtcaccact
tgtgcatga

DBGET integrated database retrieval system