KEGG   Danio rerio (zebrafish): 436997Help
Entry
436997            CDS       T01004                                 

Gene name
zgc:92591
Definition
(RefSeq) uncharacterized protein LOC436997
  KO
K11252  histone H2B
Organism
dre  Danio rerio (zebrafish)
Brite
Chromosome [BR:dre03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    436997 (zgc:92591)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   436997 (zgc:92591)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa CENP-W TAF
Motif
Other DBs
NCBI-GeneID: 436997
NCBI-ProteinID: NP_001002724
ZFIN: ZDB-GENE-040718-483
Ensembl: ENSDARG00000088276
Vega: OTTDARG00000022356
UniProt: Q6DH91
Position
24
AA seq 117 aa AA seqDB search
MSNEGAKKKGKAPGDKKGSKRKSKRRETYAVYIYKVLKQVHPDTGISSRAMSIMNSFVND
VFERIATEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatgaaggagcaaaaaagaagggcaaagcgccaggggacaaaaaaggatctaaa
cggaagtcaaagagaagggaaacctatgcagtctacatctacaaagttttgaagcaggtt
catccagacactggcatctccagcagggcgatgagcatcatgaactcgtttgtcaatgat
gttttcgagcgcattgccacagaagcgtcccgactggcgcattacaacaagcgctccacc
atcaccagcagagaagtgcagaccgcggtccggctcctgctgcctggagaactggccaag
cacgccgtgtctgagggcaccaaagctgtcaccaaatacaccagctccaagtga

DBGET integrated database retrieval system