KEGG   Danio rerio (zebrafish): 437013Help
Entry
437013            CDS       T01004                                 

Gene name
eef2k, cb365, fa04b08, wu:fa04b08, zgc:100973
Definition
elongation factor-2 kinase (EC:2.7.11.20)
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     437013 (eef2k)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   437013 (eef2k)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
12
AA seq 706 aa AA seqDB search
MAEEELMFSMEEVGSARDGSRNRCVKNRVCFQNSNASDDDDEEDEDDLRICPITDDIISP
TKGFCEFPKNLAHNQQLSNSLPKNSFTYKATWKHAIEKAKAMPDPWAEFHLEEMETERCT
RYRYSAITGEWAKDEIFIKVSSQTFGKGAMRECFRAKKLSNFSHSHNWKSASNYVAKRYM
ETVDRSVYFEDVRLQMEAKLWGEEFNRHRPPKQVDIMQMCVVEMTTRPGSPLFHLEHYIE
GKYTKYNSNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTSKGT
DFGDGNLGVRGMALFFHSHLCNKICRSMGLTRFDLSPAEIAQLDCTNKLLQSAKTVLRGF
EEQCGSPRVRTTSLGHMPVLLSRLSETSSVDESSDTDSIPCSPLSMGVSVGRSPMGWSFM
NEMNETHRSQNTEQQDSENGGDSGYPSEKRSEGDPVEHHGQLTEEKWSFYHSSRSHIHRP
SCVAVEVERLNALLLEKKIGKSILGKVHLAMVRYHEAGRFCEKDEPWDQISAMYHLETAA
MCGELEAIVALGQCYLQLPHHILPEIELEPSEENSQKGFRFLLQAAEAGDRPSMILVARA
FDTGLKLPSDRAMDWTEAVHWYDSALKMTDYDEGGEFDGMQDEPRYLLLARLAEMYQEGG
NNLDADPQRAGDLFTEAADAAMEAMKGRLANQYYMKAEEAWAMMEE
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaggagctcatgtttagcatggaggaggtgggcagtgctcgcgatggctcg
aggaatagatgtgttaagaacagagtctgttttcaaaactctaatgcgagtgatgatgat
gacgaagaagatgaagatgacctccgtatctgtcccatcaccgacgacatcataagccca
accaaaggcttttgtgaattcccaaagaacctcgctcataaccagcagctttccaattca
ctccccaaaaactcattcacgtacaaggcaacttggaaacatgctattgagaaagccaaa
gccatgccagatccttgggctgagtttcatctggaggaaatggagactgagcgctgcact
cgatacagatacagtgcaattactggagaatgggcaaaggatgaaatatttatcaaggtt
tcctctcagacatttggaaagggagccatgagggaatgcttcagagcgaagaagttatca
aacttctcccacagccacaactggaaatcagcctcaaactatgtggctaagagatacatg
gagacggtggatagaagtgtttactttgaggatgtgaggttacagatggaggctaaattg
tggggcgaggagttcaatcgccacaggcctcccaaacaggtggacatcatgcagatgtgt
gtcgtggaaatgaccacgcgaccaggcagccctttgtttcacttggagcactacattgag
gggaaatacacaaagtacaactccaactctggttttgtgagggacgataacatacggctc
actccacaggcatttagccatttcacatttgagcgctctggacaccagctgatagtggtg
gacattcagggtgttggtgatctttacacggaccctcaaatccacacttcgaaagggact
gactttggagatggcaacctgggtgtccgtggcatggctcttttcttccactctcacctg
tgtaataagatctgtagaagcatgggcctgactcgctttgacttgtcccctgctgaaatt
gcacaactggactgcaccaacaaactgctgcagtcagccaagactgttctgcgggggttt
gaagagcagtgcggttcgcccagggtgaggaccacctctctcggacacatgcccgttctc
ctgtcccggctctctgagacttcctcagtggatgaaagcagtgacacggactcgattccc
tgttcaccacttagcatgggagtctctgtaggccgctcacccatgggctggtcatttatg
aatgaaatgaatgaaacacaccgatcacagaacacagaacaacaggactctgaaaatgga
ggagacagtggttacccaagtgagaaacgcagtgaaggagacccagtcgaacatcatggt
cagctgacagaagagaagtggagtttctaccattcatctcgctctcacatacacagaccc
tcctgtgtggcagtggaggtggagagacttaacgctctgcttctcgaaaagaaaattgga
aaatccatcctaggaaaggttcatctagctatggtccgctaccacgaggccggacgcttc
tgtgagaaggatgaaccatgggaccagatttctgcaatgtatcatctggaaacagcagcc
atgtgtggagaactggaggctatcgttgctcttggccagtgttaccttcagctgccacat
cacattctaccagagattgaattagagccgtctgaggaaaacagccagaaaggtttccgc
ttcctgctgcaggctgccgaggcaggagatcggccgagcatgattctggtggcacgagca
ttcgacactggtctgaagctcccttctgatagggctatggactggacagaagctgtgcac
tggtatgactccgccctaaagatgacagactatgacgagggtggagagtttgacgggatg
caggatgagccacgataccttctgctggcacgtctggctgagatgtaccaggagggtgga
aacaacctggatgcagaccctcaaagagcaggagatcttttcactgaggcagctgacgca
gcaatggaggccatgaagggcagactggccaatcaatactacatgaaagcagaagaagca
tgggctatgatggaagaataa

DBGET integrated database retrieval system