KEGG   Danio rerio (zebrafish): 445076Help
Entry
445076            CDS       T01004                                 

Gene name
prkacab
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04020  Calcium signaling pathway
dre04114  Oocyte meiosis
dre04140  Autophagy - animal
dre04261  Adrenergic signaling in cardiomyocytes
dre04270  Vascular smooth muscle contraction
dre04310  Wnt signaling pathway
dre04340  Hedgehog signaling pathway
dre04371  Apelin signaling pathway
dre04530  Tight junction
dre04540  Gap junction
dre04910  Insulin signaling pathway
dre04912  GnRH signaling pathway
dre04914  Progesterone-mediated oocyte maturation
dre04916  Melanogenesis
Module
dre_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    445076 (prkacab)
   04310 Wnt signaling pathway
    445076 (prkacab)
   04340 Hedgehog signaling pathway
    445076 (prkacab)
   04371 Apelin signaling pathway
    445076 (prkacab)
   04020 Calcium signaling pathway
    445076 (prkacab)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    445076 (prkacab)
  Cell growth and death
   04114 Oocyte meiosis
    445076 (prkacab)
  Cellular community - eukaryotes
   04530 Tight junction
    445076 (prkacab)
   04540 Gap junction
    445076 (prkacab)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    445076 (prkacab)
   04912 GnRH signaling pathway
    445076 (prkacab)
   04914 Progesterone-mediated oocyte maturation
    445076 (prkacab)
   04916 Melanogenesis
    445076 (prkacab)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    445076 (prkacab)
   04270 Vascular smooth muscle contraction
    445076 (prkacab)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     445076 (prkacab)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: AGC group
  PKA family
   445076 (prkacab)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     445076 (prkacab)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    445076 (prkacab)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 445076
NCBI-ProteinID: NP_001003470
ZFIN: ZDB-GENE-040801-208
Ensembl: ENSDARG00000016809
Vega: OTTDARG00000029883
UniProt: Q6DBV8
Position
1
AA seq 351 aa AA seqDB search
MGNTPAAKRGNEMESVKEFLAFAKEDFLRKWENPAQNTACLEDFDRLKTLGTGSFGRVML
VRHRETGQHYAMKILNKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYSFKDNTNLYMV
MQYVQGGEMFSHLRRIGRFSEPHARFYASQIVLTFEYLHALDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLMYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFST
TDWIAIYQRRVEAPFVPKCRGPGDTSNFDDYEEEEIRVSFTEKCAKEFAEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacacgccggccgccaaacggggcaacgaaatggaaagcgtcaaagagtttctg
gccttcgccaaagaagatttcctcaggaaatgggagaatcctgcacagaacaccgcctgc
ctggaggacttcgaccggttgaaaactctgggcactggttcattcggccgcgtgatgctg
gtcagacaccgagagacaggacagcactacgccatgaagatcctcaacaaacagaaggtg
gtgaagctgaagcagattgaacacactctgaatgagaagcggatactgcaggccgtcagc
ttccccttcttagtgcgactggagtactccttcaaggacaacaccaatctctacatggtg
atgcagtacgttcagggaggagagatgttttcacacctgcgcagaatcggcagattcagt
gaacctcacgcgcgcttctatgcttcacaaatagttttgacctttgaatatctgcatgcc
cttgacctgatctacagagaccttaaaccagaaaacctcctcatcgatcagcagggctac
atccaggtcacagactttggtttcgccaagcgggtcaagggccgcacgtggacattgtgt
gggaccccagagtatctggctccagagatcatcctcagcaagggttataataaggctgtg
gactggtgggctctgggggtgctgatgtacgagatggcagctggttatcctccgtttttc
gcagatcaacccattcagatctacgaaaagattgtctcaggaaaggtacgattcccgtcg
cacttcagctcggacctgaaggacctgttgaggaacctgctgcaggtggatctcaccaag
cgctacggaaacctcaagaacggagtcaacgatattaaaggacacaagtggttctctacc
actgactggatcgccatttaccagcggagggtggaggccccgtttgtgcctaaatgcaga
ggtcccggggacaccagcaactttgatgactatgaggaggaagagatccgcgtgtcgttc
accgagaagtgtgcgaaagaattcgccgagttctag

DBGET integrated database retrieval system