KEGG   Danio rerio (zebrafish): 445091Help
Entry
445091            CDS       T01004                                 

Gene name
zgc:92480
Definition
(RefSeq) uncharacterized protein LOC445091
  KO
K03853  calpain-2 [EC:3.4.22.53]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04141  Protein processing in endoplasmic reticulum
dre04210  Apoptosis
dre04217  Necroptosis
dre04218  Cellular senescence
dre04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    445091 (zgc:92480)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    445091 (zgc:92480)
   04217 Necroptosis
    445091 (zgc:92480)
   04218 Cellular senescence
    445091 (zgc:92480)
  Cellular community - eukaryotes
   04510 Focal adhesion
    445091 (zgc:92480)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.53  calpain-2
     445091 (zgc:92480)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C2: calpain family
   445091 (zgc:92480)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_1 EF-hand_6 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 445091
NCBI-ProteinID: NP_001003485
ZFIN: ZDB-GENE-040801-227
Ensembl: ENSDARG00000034211
UniProt: Q6DFZ8
Position
22
AA seq 700 aa AA seqDB search
MSGIAIKLQHKRAQAAGIGTNAQAVKFLNQDYEALKRECLESGRLFHDDMFEANVSALGF
KELGPNSSKVRGVEWLRPKQLTSNPTFISGGATRTDICQGALGDCWLLAAIASLTLNQDV
FARVVPAGQSFDGDYAGIFHFQFWQFGEWVDVVIDDRLPARNGELLFVHSAEGSEFWSAL
LEKAYAKLNGCYEALSGGTTTEGFEDFTGGIAEVHELAKAGPNLFKTIQKALSWGSLLGC
SIDITSSSDSEAITSQKLVKGHAYSVTGAEEVEYRGDLTKLIRIRNPWGQVEWTGPWSDG
SSEWRQISDNDRERLSSKAEDGEFWMSFSDFMRHYSRVEICNLTPDALTDESVNKWALSK
FDGNWRNGSTAGGCRNYPNSFWMNPQFLIKLEEQDDDPTDNEAGCSFVVGLIQKNRRKMR
KVGEDMNTIGFAIYEVPDQFVGQRNVHLDRNFFVRHASAARSETFINLREVCSRFCLPPG
EYLIVPSTFEPNKDGDFCVRVFSEKQAEFQELDDPVESKVAEIEITEGDIDSRFKKLFGQ
LAGADCEISAFELQKILNNVIAKRKEIKTDGFSLETCRNMVNLLDKDGTGKLGLLEFKIL
WTKIELFVDVYSKNDKDQSGTMSSMEMREAVEKAGFSLNNALHQILVARYSESNLTIDFD
NFVACLIRLECMFKAFKVLDKDKNGTVELNMIEWLNVSML
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaatcgcgattaaactccaacacaagcgggcacaagcggcgggcatcggtacc
aacgctcaagcggtcaaattccttaaccaggactatgaagccctcaaacgagagtgtctg
gagtccggacgtctgtttcacgatgacatgtttgaagctaatgtgtctgccctcgggttt
aaggaactaggaccaaactcgtctaaagtgcgcggggttgagtggctgagacccaaacaa
ctgacgtccaacccaacattcattagtggaggagcgaccagaacagacatctgccagggc
gctttgggtgactgttggctattagcagccatcgcttctcttaccctgaaccaggacgtg
tttgctcgtgttgtgccagctggtcagagttttgatggcgactatgctggaatatttcat
tttcagttttggcagtttggtgaatgggtggatgtagtcatcgatgaccggctgccggct
agaaacggagagctgctgtttgtccactcggccgagggctctgagttctggagtgctctt
ttggagaaagcctatgcaaagttgaacggctgctatgaagctctttctggaggcaccacc
actgaaggttttgaggatttcactggaggcattgccgaggtccacgaactggccaaagca
ggtccaaacctcttcaaaaccatccagaaggctcttagctggggctcgttgctgggctgc
tccatagatatcacaagctcttctgactcagaggccattactagtcagaaactggtgaaa
ggacacgcctactcggttacaggagctgaagaggtggagtacaggggtgacttaactaaa
ctgattcgaatcaggaacccctgggggcaggtcgagtggacgggaccctggagtgatggg
tcatcagaatggcgtcagatcagtgacaacgacagagaaagactgagctccaaagctgaa
gatggagaattctggatgtctttctctgacttcatgcgtcattactcacgggtggagatc
tgcaatctgacgcccgatgcgctcacagatgaaagtgttaataaatgggctctgtccaag
tttgatggcaactggaggaatggatcaactgctggaggctgcaggaattaccccaactcg
ttctggatgaatcctcagtttctgattaaactggaggagcaggatgacgacccgactgat
aatgaagcaggatgcagctttgttgtgggactgatccagaagaaccgccgcaaaatgagg
aaggtcggagaggacatgaacaccatcggctttgcaatctatgaggttcctgaccagttt
gtgggacagcggaacgtccatctggatcgtaactttttcgtgcgacatgcatcagctgct
cggtccgagaccttcatcaacctgcgggaggtttgctctcgcttctgtctgccccccggc
gagtacctcatcgtgccctctacttttgagcccaacaaagatggtgacttctgtgtccgc
gttttctcagaaaaacaagcagagttccaagagcttgatgatcctgtcgagtccaaggtt
gcggagattgaaataacagagggtgatattgatagccgcttcaagaaactgtttggacag
cttgctggagctgactgtgagatctctgcatttgagctgcaaaaaatcctgaacaatgtg
atagctaaacgcaaagagattaaaactgatggatttagtttggagacttgccgcaacatg
gtgaacctactggataaagacggcactggaaaactaggcctgcttgaatttaagattctg
tggactaaaattgagctgttcgtggacgtctacagtaaaaatgacaaagaccagtctggc
acaatgagctctatggagatgagagaagccgtagagaaagcagggttttctctgaataat
gctctacaccagatccttgttgcacgatacagcgaatccaacctcaccatcgactttgac
aactttgtggcctgtcttatacgcctcgaatgcatgttcaaggcatttaaggtgctggac
aaggacaagaatggcaccgtcgagctgaacatgattgagtggctgaatgtttccatgctc
tga

DBGET integrated database retrieval system