KEGG   Danio rerio (zebrafish): 445118Help
Entry
445118            CDS       T01004                                 

Gene name
g6pca.1
Definition
(RefSeq) glucose-6-phosphatase a, catalytic subunit, tandem duplicate 1 isoform 1
  KO
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    445118 (g6pca.1)
   00052 Galactose metabolism
    445118 (g6pca.1)
   00500 Starch and sucrose metabolism
    445118 (g6pca.1)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    445118 (g6pca.1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    445118 (g6pca.1)
   04920 Adipocytokine signaling pathway
    445118 (g6pca.1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     445118 (g6pca.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
12
AA seq 352 aa AA seqDB search
MDLLHSWGVELAVHLQIKYQDYESVFHWVSSLADLHTTFFVFFPVWFHLRRDVAVKLIWV
AVVGDWLNLVLKWVLFGERPYWWVHETKFYGSMKHPELQQFSMTCETGPGSPSGHAMGSA
AVGYVMITALLSILAERKLPPLIYRLVQLMLWMFLGLVELLVCMSRVYLAAHFPHQVICG
VISGIIVAETFSRVQWIYSASLKKYFSITLFLLSFAVGFYVLLKALGVDLLWTLEKAQKW
CINPAWVLMDATPFASLLRNMGTLFGLGLGLHLSHYDPGSSKKHTCICFRIGCIGVSLVL
LQLLDKMTFSSSSQLFYLLSFCKSAVALLLPTALVPGIMYWITQKSKHEKDM
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggatcttcttcacagctggggtgtggagctggccgtccacttacagatcaaataccag
gattatgagagcgtgtttcactgggtctcctctctggctgatctacacaccaccttcttt
gtgtttttccccgtctggtttcatctgcgcagagatgtggctgttaaactcatctgggtg
gccgtggttggagactggctgaacctcgtcctaaagtgggtgctgtttggtgagaggcct
tactggtgggtgcatgaaactaagttttatggctcaatgaaacatcccgaactgcaacag
ttctccatgacatgtgaaactggaccaggcagcccgtcgggtcatgccatgggctctgct
gctgttggatatgtgatgatcacagcgttgctttcaatccttgctgaaagaaaattacct
cctttaatttacagacttgtacagttgatgctgtggatgtttctgggtttggtagagttg
ctggtttgcatgtctagagtgtatctggccgctcatttcccacaccaagtaatctgtgga
gttatttcaggtataattgtagcagaaaccttctccagagtgcagtggatctatagtgcg
agtctgaagaagtacttcagcatcacgctgttcctgctgtcattcgctgtgggcttttat
gtgctcctgaaggctcttggtgtggatctgctctggactcttgagaaagcccagaaatgg
tgcataaatccagcctgggttttaatggacgccacaccgttcgccagcctgctgaggaac
atgggcacccttttcggcctgggtctcggccttcatttgtctcactacgatccaggaagt
agtaagaaacacacttgcatttgtttcaggattggatgtattggtgtatcactggttttg
ctgcagcttctggataagatgacattttcctccagcagccagttattttatcttctgtcg
ttctgtaaaagcgctgtggctttgctgcttcccactgcacttgttcctggaatcatgtac
tggattacacaaaaaagcaagcatgagaaggacatgtag

DBGET integrated database retrieval system