KEGG   Danio rerio (zebrafish): 445123Help
Entry
445123            CDS       T01004                                 

Gene name
zgc:100906
Definition
(RefSeq) protein disulfide-isomerase A3 precursor
  KO
K08056  protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    445123 (zgc:100906)
Enzymes [BR:dre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     445123 (zgc:100906)
Chaperones and folding catalysts [BR:dre03110]
 Protein folding catalysts
  Protein disulfide isomerase
   445123 (zgc:100906)
Membrane trafficking [BR:dre04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    445123 (zgc:100906)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   445123 (zgc:100906)
  Exosomal proteins of colorectal cancer cells
   445123 (zgc:100906)
  Exosomal proteins of bladder cancer cells
   445123 (zgc:100906)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_7 Thioredoxin_2 OST3_OST6 Thioredoxin_8 Calsequestrin AhpC-TSA Thioredoxin_3
Motif
Other DBs
NCBI-GeneID: 445123
NCBI-ProteinID: NP_001003517
ZFIN: ZDB-GENE-040801-20
Ensembl: ENSDARG00000033599
Vega: OTTDARG00000031717
UniProt: Q6DEI4
Position
19
AA seq 493 aa AA seqDB search
MDEMILRGLLCILVCSLSSSAREHSDVLKLTDADFDYLAPEHETLLVKFYAPWCGHCKKL
APEFESAASRLKGTVTLAKVDCTANTEICKHYGVNGYPTLKIFRNGQESSSYDGPRSADG
IVDYMKKQAGPDSVLLHSELDLEKFINHFDASVVGLFSGTDSSQLAEFLKGASLMRESFR
FAHTTDLQLGQKYGVTHESILLFRAPRLSSKFEESVVPHTGSLSVTGLRRFIRDNIFGLC
PHMTKDNKEVLRKRDLLTAYYDLDYLHNPKGSNYWRNRVLKVATKFSSQGMLFSVANRND
FMEELEEEFGLSASDGNELPFVTIRTRTGDKYSMREEFTRDGKSLESFLEDYFAGRLKRY
VKSEPVPAINNGVVKVVVADTFEEIVNDPEKDVLIEFYAPWCGHCKKLEPKYTALGEMLY
SDPNIVIAKMDATVNDVPAGYDVQGFPTIYFAAAGRKSEPKRYEGAREVKDFVNFLKREA
TKPLILNGVKEEL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaatgattttgcgcgggcttttatgtatattggtgtgttcgttgagctcgtcg
gcgcgtgaacacagtgatgtgctcaagctgacagacgcggacttcgactacctcgcgccc
gagcacgagaccctgctggtgaagttttatgctccatggtgtggtcactgtaagaaactt
gccccagagtttgaaagtgcagcttctcgactgaagggaacagttactttagccaaggtg
gactgtaccgctaatacagagatctgtaagcactacggtgtaaatggataccccacactc
aaaatatttcgtaatgggcaggaatcatcttcgtatgatgggccgcgctccgctgatgga
atcgtggactatatgaagaaacaggccggtcctgattctgtgcttctgcatagtgagctt
gatctggagaaattcatcaatcattttgatgccagtgtagttgggttgttctcaggtacc
gacagctctcagcttgctgagtttcttaaaggagccagtttaatgagggaaagtttccgc
tttgcccacaccacagacctccagcttggacagaaatatggtgtcacacatgaatccatt
cttctgttccgtgcgcccagactaagcagtaagtttgaggagagtgtggttcctcacaca
ggatcactgtccgtcactggcctgcgtcgcttcatcagagacaacatttttgggctctgt
ccgcacatgaccaaagataataaggaggtactaaggaagagggatttactaactgcttac
tatgacttggattatcttcacaacccaaaaggctccaactattggaggaacagagtgctg
aaggtggcaactaagttcagttctcagggcatgctgttctcagtggcgaaccgtaatgac
tttatggaggagcttgaggaagagtttggtctgagtgcatcagatggaaatgagttgccc
tttgtcaccatcaggacacgaacaggagacaaatacagtatgagggaggagtttacacga
gatggcaagtctctagagagttttctagaagactattttgctggccgtctcaagcgttac
gtcaaatccgagcctgttcctgccataaacaatggagtggttaaggtggttgtggcagat
acgtttgaagaaatcgtcaacgacccagaaaaagacgtgctgattgagttttatgctcca
tggtgtggccattgcaagaaactggagcccaaatacacagcgcttggagaaatgctatac
agtgatcccaatattgtaatagccaagatggatgcgactgtcaacgatgttcctgcaggc
tatgatgtgcaaggatttcctacaatatattttgctgctgctgggagaaagagtgagcca
aaacgatatgagggagctcgtgaagtgaaggattttgtcaacttcctgaagcgtgaagct
accaaacctcttattctcaatggagtcaaggaagaactgtaa

DBGET integrated database retrieval system