KEGG   Danio rerio (zebrafish): 445123Help
Entry
445123            CDS       T01004                                 

Definition
zgc:100906 (EC:5.3.4.1)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    445123
Enzymes [BR:dre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     445123
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   445123
  Exosomal proteins of colorectal cancer cells
   445123
  Exosomal proteins of bladder cancer cells
   445123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
19
AA seq 493 aa AA seqDB search
MDEMILRGLLCILVCSLSSSAREHSDVLKLTDADFDYLAPEHETLLVKFYAPWCGHCKKL
APEFESAASRLKGTVTLAKVDCTANTEICKHYGVNGYPTLKIFRNGQESSSYDGPRSADG
IVDYMKKQAGPDSVLLHSELDLEKFINHFDASVVGLFSGTDSSQLAEFLKGASLMRESFR
FAHTTDLQLGQKYGVTHESILLFRAPRLSSKFEESVVPHTGSLSVTGLRRFIRDNIFGLC
PHMTKDNKEVLRKRDLLTAYYDLDYLHNPKGSNYWRNRVLKVATKFSSQGMLFSVANRND
FMEELEEEFGLSASDGNELPFVTIRTRTGDKYSMREEFTRDGKSLESFLEDYFAGRLKRY
VKSEPVPAINNGVVKVVVADTFEEIVNDPEKDVLIEFYAPWCGHCKKLEPKYTALGEMLY
SDPNIVIAKMDATVNDVPAGYDVQGFPTIYFAAAGRKSEPKRYEGAREVKDFVNFLKREA
TKPLILNGVKEEL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaatgattttgcgcgggcttttatgtatattggtgtgttcgttgagctcgtcg
gcgcgtgaacacagtgatgtgctcaagctgacagacgcggacttcgactacctcgcgccc
gagcacgagaccctgctggtgaagttttatgctccatggtgtggtcactgtaagaaactt
gccccagagtttgaaagtgcagcttctcgactgaagggaacagttactttagccaaggtg
gactgtaccgctaatacagagatctgtaagcactacggtgtaaatggataccccacactc
aaaatatttcgtaatgggcaggaatcatcttcgtatgatgggccgcgctccgctgatgga
atcgtggactatatgaagaaacaggccggtcctgattctgtgcttctgcatagtgagctt
gatctggagaaattcatcaatcattttgatgccagtgtagttgggttgttctcaggtacc
gacagctctcagcttgctgagtttcttaaaggagccagtttaatgagggaaagtttccgc
tttgcccacaccacagacctccagcttggacagaaatatggtgtcacacatgaatccatt
cttctgttccgtgcgcccagactaagcagtaagtttgaggagagtgtggttcctcacaca
ggatcactgtccgtcactggcctgcgtcgcttcatcagagacaacatttttgggctctgt
ccgcacatgaccaaagataataaggaggtactaaggaagagggatttactaactgcttac
tatgacttggattatcttcacaacccaaaaggctccaactattggaggaacagagtgctg
aaggtggcaactaagttcagttctcagggcatgctgttctcagtggcgaaccgtaatgac
tttatggaggagcttgaggaagagtttggtctgagtgcatcagatggaaatgagttgccc
tttgtcaccatcaggacacgaacaggagacaaatacagtatgagggaggagtttacacga
gatggcaagtctctagagagttttctagaagactattttgctggccgtctcaagcgttac
gtcaaatccgagcctgttcctgccataaacaatggagtggttaaggtggttgtggcagat
acgtttgaagaaatcgtcaacgacccagaaaaagacgtgctgattgagttttatgctcca
tggtgtggccattgcaagaaactggagcccaaatacacagcgcttggagaaatgctatac
agtgatcccaatattgtaatagccaagatggatgcgactgtcaacgatgttcctgcaggc
tatgatgtgcaaggatttcctacaatatattttgctgctgctgggagaaagagtgagcca
aaacgatatgagggagctcgtgaagtgaaggattttgtcaacttcctgaagcgtgaagct
accaaacctcttattctcaatggagtcaaggaagaactgtaa

DBGET integrated database retrieval system