KEGG   Danio rerio (zebrafish): 445246Help
Entry
445246            CDS       T01004                                 

Gene name
aurka, wu:fb37c10, wu:fc02c02, zgc:100912
Definition
aurora kinase A (EC:2.7.11.1)
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    445246 (aurka)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     445246 (aurka)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   445246 (aurka)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     445246 (aurka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
6
AA seq 405 aa AA seqDB search
MDSGARSKSSRDLKIHRPENEKVSAAGPKRVPVTQSVQKPVSNPHTRVLGAAQGPQRVQR
PVGKTSCPGDQNTRPEQHKPAAHSKPQPKPPLSAETNKTAEPSKQDKPHQTPSSTTSTSS
NTSGSSKSSKKAWTLENFDIGRALGKGKFGSVYLAREQQTKFILALKVLFKKQLEKAGVE
HQLRREVEIQSHLRHPNILRLYGYFHDAARVYLILEFAPKGELYGELQRCGTFDDQRSAT
YIMELADALRYCHSKAVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDY
LPPEMIEGKTHDEKVDLWSLGVLCYEFLVGRPPFETKSHEETYRKISRVEFTYPAHVSNG
SRDLINRLLKHNPMHRLPIQGVMEHPWVVENSTKKPTTYTATANN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggactctggtgcaagaagcaaatcaagcagagatctgaagattcatcgacctgaaaat
gagaaggtttctgccgctggacccaaaagagttcctgtaacccagagcgtgcagaagcca
gtgtcgaacccacacacgcgtgttctcggcgctgcacagggaccacagcgtgtccaacgt
cctgttgggaaaacctcttgtcctggagaccagaacacccgtccagaacagcacaaacca
gcagcgcacagcaaaccacagccaaaaccaccgctgtcagcggagaccaacaaaactgca
gaacccagcaaacaggataaacctcaccaaactccttccagtactacttctacctcctcc
aacaccagtggatcatcgaagagttcaaaaaaagcctggactttggagaatttcgacatt
ggccgcgctctgggcaaggggaagtttggcagcgtgtatctggccagagaacagcagacc
aagtttattctggcgctcaaagttctgttcaagaagcagctggagaaagcaggagtggag
catcagctgcgcagggaggtggagatacagtcacatctcagacatcccaatatcctgcgt
ttgtatggttatttccacgacgcggcccgtgtttacctcatcctagagtttgctcctaaa
ggagagctgtatggagaactgcagcgctgcgggacgttcgatgaccagagaagcgccacg
tatataatggagttggcggatgctctgagatactgccactcgaaggctgtgatccacaga
gatattaaacctgaaaacctgctgctgggagccaatggagagctgaagattgcagatttt
ggctggtccgtccacacgccctcctccaggaggtcgacgctgtgcggcacactggactat
cttcctccagagatgattgaaggtaaaacacatgatgagaaggtggatctctggagtctt
ggagtgctctgctatgagtttctggttggcaggccaccttttgaaacaaagagtcatgaa
gagacgtaccgcaagatttctagagttgagtttacttatccagctcatgtgagcaacggc
agcagagacctgatcaatcgactactcaagcacaacccaatgcacagactccccatccag
ggagtaatggagcacccgtgggttgtggaaaactccaccaagaaaccaaccacttacacc
gccaccgccaacaactga

DBGET integrated database retrieval system