KEGG   Danio rerio (zebrafish): 445246Help
Entry
445246            CDS       T01004                                 

Gene name
aurka, wu:fb37c10, wu:fc02c02, zgc:100912
Definition
(RefSeq) aurora kinase A (EC:2.7.11.1)
  KO
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    445246 (aurka)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     445246 (aurka)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: AGC group
  AUR family [OT]
   445246 (aurka)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     445246 (aurka)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    445246 (aurka)
   Spindle formation proteins
    445246 (aurka)
  Sister chromatid separation proteins
   Aurora kinases
    445246 (aurka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
6
AA seq 405 aa AA seqDB search
MDSGARSKSSRDLKIHRPENEKVSAAGPKRVPVTQSVQKPVSNPHTRVLGAAQGPQRVQR
PVGKTSCPGDQNTRPEQHKPAAHSKPQPKPPLSAETNKTAEPSKQDKPHQTPSSTTSTSS
NTSGSSKSSKKAWTLENFDIGRALGKGKFGSVYLAREQQTKFILALKVLFKKQLEKAGVE
HQLRREVEIQSHLRHPNILRLYGYFHDAARVYLILEFAPKGELYGELQRCGTFDDQRSAT
YIMELADALRYCHSKAVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDY
LPPEMIEGKTHDEKVDLWSLGVLCYEFLVGRPPFETKSHEETYRKISRVEFTYPAHVSNG
SRDLINRLLKHNPMHRLPIQGVMEHPWVVENSTKKPTTYTATANN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggactctggtgcaagaagcaaatcaagcagagatctgaagattcatcgacctgaaaat
gagaaggtttctgccgctggacccaaaagagttcctgtaacccagagcgtgcagaagcca
gtgtcgaacccacacacgcgtgttctcggcgctgcacagggaccacagcgtgtccaacgt
cctgttgggaaaacctcttgtcctggagaccagaacacccgtccagaacagcacaaacca
gcagcgcacagcaaaccacagccaaaaccaccgctgtcagcggagaccaacaaaactgca
gaacccagcaaacaggataaacctcaccaaactccttccagtactacttctacctcctcc
aacaccagtggatcatcgaagagttcaaaaaaagcctggactttggagaatttcgacatt
ggccgcgctctgggcaaggggaagtttggcagcgtgtatctggccagagaacagcagacc
aagtttattctggcgctcaaagttctgttcaagaagcagctggagaaagcaggagtggag
catcagctgcgcagggaggtggagatacagtcacatctcagacatcccaatatcctgcgt
ttgtatggttatttccacgacgcggcccgtgtttacctcatcctagagtttgctcctaaa
ggagagctgtatggagaactgcagcgctgcgggacgttcgatgaccagagaagcgccacg
tatataatggagttggcggatgctctgagatactgccactcgaaggctgtgatccacaga
gatattaaacctgaaaacctgctgctgggagccaatggagagctgaagattgcagatttt
ggctggtccgtccacacgccctcctccaggaggtcgacgctgtgcggcacactggactat
cttcctccagagatgattgaaggtaaaacacatgatgagaaggtggatctctggagtctt
ggagtgctctgctatgagtttctggttggcaggccaccttttgaaacaaagagtcatgaa
gagacgtaccgcaagatttctagagttgagtttacttatccagctcatgtgagcaacggc
agcagagacctgatcaatcgactactcaagcacaacccaatgcacagactccccatccag
ggagtaatggagcacccgtgggttgtggaaaactccaccaagaaaccaaccacttacacc
gccaccgccaacaactga

DBGET integrated database retrieval system