KEGG   Danio rerio (zebrafish): 445302Help
Entry
445302            CDS       T01004                                 

Gene name
thoc3, zgc:100815
Definition
THO complex 3
Orthology
K12880  
THO complex subunit 3
Organism
dre  Danio rerio (zebrafish)
Pathway
RNA transport
Spliceosome
Module
TREX complex
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:dre03040]
Genetic Information Processing; Translation; RNA transport [PATH:dre03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
14
AA seq 322 aa AA seqDB search
MASSYYQEMQEVFRNNNKSREFPAHSAKVHSVAWSCDGKRLASGSFDKTASVFVLEKDRL
VKENNYRGHGDSVDQLCWHPTNPDLFVTASGDKTIRIWDVRTTKCMATVSTKGENINICW
SPDGQTIAVGNKDDVVTFIDAKTHRPRAEEQFKFEVNEISWNNDNDMFFLTNGNGCINIL
SYPELKLIQSINAHPSNCICIKFDPTGKYFATGSADALVSLWNVEELVCVRCFSRLDWPV
RTLSFSHDGKMLASASEDHFIDIAEVETGEKLWEIQCESPTFTVAWHPKRPLLAYACDDK
EGKYDSNREAGTVKLFGLPNDS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctcgtactatcaggagatgcaggaggtgttcaggaataacaataaaagcaga
gagttcccggctcacagtgctaaagtgcactcggtggcctggagctgtgatggaaaacga
ctggcgtccggttcgtttgacaaaactgccagcgtatttgtcctggaaaaagaccgactg
gtgaaggaaaacaactaccgtgggcatggagacagtgtggatcagctgtgctggcatccc
accaaccctgatctgttcgttactgcatcaggagacaagaccatccgcatctgggatgtg
cggaccaccaaatgcatggccacagtcagcacaaaaggggagaatatcaacatttgctgg
agtcctgatggtcagaccatcgctgtaggtaacaaggatgatgttgtaacgttcattgat
gccaaaacacaccgtccacgtgctgaggagcagttcaagtttgaggtcaacgaaatctcc
tggaataatgacaatgacatgttcttcctgaccaacggcaatggatgcatcaatatatta
agttaccctgaactgaagctcatccagtcaattaatgcccatccatccaactgcatctgc
attaagtttgatccgactgggaagtattttgccactggaagtgcagatgccctggtcagc
ctgtggaacgtggaggagctggtgtgtgtgcgatgcttctcaagactggactggcctgta
cgaactcttagcttcagtcatgatggtaaaatgctggcatctgcatcagaagaccatttc
attgacatagcagaagtagagacaggggagaaactgtgggaaattcagtgcgagtctcca
accttcactgtagcctggcatccgaagaggccgctgttagcatatgcctgtgacgataaa
gagggcaaatacgacagcaaccgagaagcgggcaccgtcaaactcttcggccttcccaat
gattcctga

DBGET integrated database retrieval system