KEGG   Danio rerio (zebrafish): 445302Help
Entry
445302            CDS       T01004                                 

Gene name
thoc3, zgc:100815
Definition
THO complex 3
Orthology
K12880  
THO complex subunit 3
Organism
dre  Danio rerio (zebrafish)
Pathway
RNA transport
Spliceosome
Module
TREX complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    445302 (thoc3)
  Translation
   03013 RNA transport
    445302 (thoc3)
Spliceosome [BR:dre03041]
 Complex C
  Other components
   EJC/TREX
    445302 (thoc3)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    445302 (thoc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
14
AA seq 322 aa AA seqDB search
MASSYYQEMQEVFRNNNKSREFPAHSAKVHSVAWSCDGKRLASGSFDKTASVFVLEKDRL
VKENNYRGHGDSVDQLCWHPTNPDLFVTASGDKTIRIWDVRTTKCMATVSTKGENINICW
SPDGQTIAVGNKDDVVTFIDAKTHRPRAEEQFKFEVNEISWNNDNDMFFLTNGNGCINIL
SYPELKLIQSINAHPSNCICIKFDPTGKYFATGSADALVSLWNVEELVCVRCFSRLDWPV
RTLSFSHDGKMLASASEDHFIDIAEVETGEKLWEIQCESPTFTVAWHPKRPLLAYACDDK
EGKYDSNREAGTVKLFGLPNDS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctcgtactatcaggagatgcaggaggtgttcaggaataacaataaaagcaga
gagttcccggctcacagtgctaaagtgcactcggtggcctggagctgtgatggaaaacga
ctggcgtccggttcgtttgacaaaactgccagcgtatttgtcctggaaaaagaccgactg
gtgaaggaaaacaactaccgtgggcatggagacagtgtggatcagctgtgctggcatccc
accaaccctgatctgttcgttactgcatcaggagacaagaccatccgcatctgggatgtg
cggaccaccaaatgcatggccacagtcagcacaaaaggggagaatatcaacatttgctgg
agtcctgatggtcagaccatcgctgtaggtaacaaggatgatgttgtaacgttcattgat
gccaaaacacaccgtccacgtgctgaggagcagttcaagtttgaggtcaacgaaatctcc
tggaataatgacaatgacatgttcttcctgaccaacggcaatggatgcatcaatatatta
agttaccctgaactgaagctcatccagtcaattaatgcccatccatccaactgcatctgc
attaagtttgatccgactgggaagtattttgccactggaagtgcagatgccctggtcagc
ctgtggaacgtggaggagctggtgtgtgtgcgatgcttctcaagactggactggcctgta
cgaactcttagcttcagtcatgatggtaaaatgctggcatctgcatcagaagaccatttc
attgacatagcagaagtagagacaggggagaaactgtgggaaattcagtgcgagtctcca
accttcactgtagcctggcatccgaagaggccgctgttagcatatgcctgtgacgataaa
gagggcaaatacgacagcaaccgagaagcgggcaccgtcaaactcttcggccttcccaat
gattcctga

DBGET integrated database retrieval system