KEGG   Danio rerio (zebrafish): 445376Help
Entry
445376            CDS       T01004                                 

Gene name
st6gal1
Definition
(RefSeq) beta-galactoside alpha-2,6-sialyltransferase 1
  KO
K00778  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00510  N-Glycan biosynthesis
dre00514  Other types of O-glycan biosynthesis
dre01100  Metabolic pathways
Module
dre_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    445376 (st6gal1)
   00514 Other types of O-glycan biosynthesis
    445376 (st6gal1)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     445376 (st6gal1)
Glycosyltransferases [BR:dre01003]
 Terminal extension
  Sialyltransferase
   445376 (st6gal1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 445376
NCBI-ProteinID: NP_001003853
ZFIN: ZDB-GENE-060322-3
Ensembl: ENSDARG00000044514
Vega: OTTDARG00000028269
UniProt: Q6KB61
Position
21
AA seq 484 aa AA seqDB search
MDRVSLLWRLRRRARRGALCMALFCLTMALLYTLCAENSIPVTDAIFGVKARTRAQPRAH
TIVKVLRGTGGSKPMYTDPQKLPGVIPGDPQKPIPILSSSNYSMESTSKDHSLGGKKRER
GLFYWLLAQPLTIFGGRRRGDMGTAIRDADVFKPNGALGEVWNEEMSSSMLGKRLRKVVQ
NYQAMNKYGVKYPATVRAAHRYKLSGPEILCEIKEKVQVTTLTPDMEPFSGFPWGSQLPP
RQITSDVGPFKTCAVVSSAGSLKNSGLGKEIDSHDAVIRFNAAPTAGFETDVGSKTTVRL
INSQLMASEDHHFLSSSLYSAGILVSWDPSPYSSDLWEWFNKTDYPIFKQYQRYRRLHPQ
QPFYIVHPRMEWQLWQRIQDNMGEAIQKNPPSSGLLGTVLMMSLCEVVHVYEFLPSRRKT
ELCHYYQRFSDAACTLGAYHPLLYEKNLVKRMNQGSDRDIYTLGRVTLPGFATFNCTSST
HSKT
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtgttagcctactttggcgattgaggcgtcgggctcgtcgaggggccctatgc
atggcactcttctgtttgactatggctctcctgtacactctttgtgctgaaaacagcatt
cctgtcacagatgccattttcggagtcaaggccagaactcgagctcaaccaagagcacac
acaattgttaaggtattgcggggaacaggagggtcaaagcccatgtatactgaccctcaa
aagctccctggtgtcattcctggagatcctcaaaagcctattcccatcctctcatcatct
aactactcaatggagagcacttctaaagaccacagtctcgggggcaaaaagagagagcgt
gggctcttttactggcttctggcacaaccactgactatttttggaggcagacggagagga
gatatggggaccgcaattcgggatgctgatgtttttaagcctaatggagcactcggagag
gtctggaatgaagagatgtcgagcagcatgctgggaaaaaggctgaggaaagttgtgcag
aactatcaggcaatgaataaatatggagtcaagtaccctgcaacagtgagagcagcacac
cgctacaaactcagtggaccagaaattctttgtgaaattaaggagaaagttcaggtcaca
actttaacaccagatatggagccattttctgggtttccatggggctctcagttacctcca
cgccaaataacctctgatgtcggcccgttcaaaacctgtgcagtggtgtcgtctgcagga
tctctcaaaaactctggattaggaaaggaaatagattctcatgacgcagtgatacgattc
aatgccgcaccgacagctggttttgagacagacgtgggctccaaaacaacagtgcgcctt
attaattcacagttaatggcatctgaagaccaccatttcctctccagctctttgtacagt
gcagggattttagtgagctgggatcctagcccttattcttcagatctatgggagtggttc
aacaagacagattaccccatatttaaacagtatcagcgatatcgccgcttgcaccctcag
cagccattttacattgtacatccgcgaatggaatggcagctgtggcagagaatacaagac
aacatgggtgaagccatccaaaaaaatccaccctcatcaggcctgctgggcacagtttta
atgatgtccctgtgtgaagtggtacacgtgtacgagttcctgccatcgcggcgaaaaacc
gagctgtgccactactaccagcgcttcagtgatgctgcctgcacactcggagcctaccac
ccattactctatgagaaaaacctggtcaagaggatgaaccaaggctccgaccgagatatc
tacacacttggcagggtcactcttcctgggttcgccacatttaactgcacttccagcact
cattcaaaaacgtaa

DBGET integrated database retrieval system