KEGG   Danio rerio (zebrafish): 445382Help
Entry
445382            CDS       T01004                                 

Gene name
nup205, zgc:111802
Definition
(RefSeq) nucleoporin 205
  KO
K14310  
nuclear pore complex protein Nup205
Organism
dre  Danio rerio (zebrafish)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    445382 (nup205)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     445382 (nup205)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    445382 (nup205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
18
AA seq 1970 aa AA seqDB search
MATQMAVNSGASLWGPLKELWEAVEGAIWRRQPESVHLLDLQLKKHKPYFLNLFKNPPKS
AEQREKVRKASTEGIAIQGQQGARLLPEQLISEAFILSDLFDLGELAALELLLAGEHQQP
HFPGLTRGLVAVLLYWDGKRCVANSLRSLIQSRHGKTFTLDLSPELVNLTTRFTDELMAQ
GLTKQILNLVSDVSVTREFERLQKERGLGNEKHRKEVSDLIKECRQSLAECLFAWACQSP
LGKDDTLALIGHLEMVTAEADGSLDSVNLALVMALLYSLDVSFLEQGTEDREDLLQALPL
LTEKQYVAAVHSRLVEGQGWKLPGLQAVVQLAWALSLRALSQLPQGAALVEFTEADEALA
DQALLGGVFLFLTEGVLGSDGFSQEEFYTRRLHSLITDFLALMPMKVKQLRNRADEDARL
IHMALQMGSEPPSSLRKDLDHLMILIGEFYSKDPFELELALEFWCPSESLQHTSLTGSFL
GVPLQRPPHKQVVLSKFVRQMGDLLPATLYIPYLRMLKGLANGPQCSHYCFSLLKTNGAP
HGENRQAGVSGSLVSWEHFFHSLMLYHENLRRDVPSADSTQYRHLPIRGITQRELEGLTA
FLQLLTTIITWSENARLALCEHPQWTPVVVMLGLLQCSVQPVLKAQVLHVLAAFGKSPEI
AASLWQSLEYTQILQTVKIPGQRQAAGIEVELNEIESSCEEYPLTRAFCHLISTLVESAL
PVNLGAGLRAPGFQPYLDFLRDSVFLAFPTRAYRRSAEKWEVAEAVLEVFHKLLREYEPQ
PSDFLPEMVELQGEQVPAHKPPGHSLMFHLLNDSPTLSLCLNLLEEGARQLDTYAQFPGK
KQLESAVLHCLCLLELALQKEVTFMDLLRESQTSLLVSPLEQLLQGVSAQSRKADHITNI
ARYLYHSSSNPDAAFQSAKILRRITRYPNIQARLVGDFTHDQAVSERLMAGFVECLDSEE
AQEGVTTNDSDSEKRVARIRHETKIHILNLLITSLELTGPNLGLYLLGYEVKKPVSSTNL
QDPGVLGCPRSCLHAILSLLQRGSDSRSGPGLIKQAPQLAELCYQVIYQLCACPDTSGPT
MRYLRTSQDFLFSHLQHLPFVLSENEIAALSQMSWLMKTTAIELRVTSLNRQRSHTQRLL
NLLLDDQPHTLHTADGETGMEEENRSVSGFLQFGTVSKVRRRLLSVLDAIDFSQEAPELL
QLDFFERTQIEQVITNCEHVNEQGHTVCNVKLLHRVLVAEINALQGMAAIGQRPLLMEEV
NSVLQQVVERNRVRRSLSAKRHALQSWRSLVETILTACPSELIPADQRQLIIRDLLLDLH
DKVLSEDAAGELMPIVAGAVFTLTAHLSQSVLSEQQGVGPEGGSGSGFASIANSALHLIL
RKLLDFILCTGGGFQRLRAHLYGALLYYLQIAQKPEEPETLQTGTSMWERLTAPEDCFSK
LQRENLSIIESYGTALMEVVCRDACDGHEIGRMLALAVLDRVLSIDRQCQWLVYLCNSGY
LRVLVESLKQDDVSLQTLLTPQPPLLKPLYIYESKMALLTRVAKTAQGAMELLRCGLVAQ
LVECQVFHMLPQNDALRVFGQRDPSGFIPSPLERYRQILLPTLRLMQVILTSTTAQHQQG
AAQVLQWLIVHSDVIQSILHGQDMSMGSLQELSLLTAIISKTALPGALEMGQEINSAALM
ELQGHIGRFQRQSLSLLVRLVGTDRARYLKQIEDTVSPSNLAEKREEMEVAMQQICANIM
EYCQTLLLQSSSEAQFSLCLFSPSASEPADVSIPSARVPSLGLVLLLLKNSASDFFRYHD
SHRQSLNKLERVEQLPPEELKELCQGLVSGSGGVEKISSVQRNVLAKRRLVQLVNNRAKL
LALCSYIIETCLFVIWRHLEFYLLYCTPTDPKDSLLPGYRDPAGSRGLSVSRVSQQDLEQ
LQSDMSSSFSEPLQRKLLEVEGLYSKSRSRHTFIQALTRRIRGLVHHAKS
NT seq 5913 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcagatggcggtaaattcaggagccagtctgtgggggccgctgaaggagctc
tgggaggctgtggaaggggccatttggagacgtcaaccagaaagtgttcatcttttagat
ctgcagttgaagaaacacaaaccctacttcctcaacctctttaaaaacccaccgaagagt
gcagaacagagagagaaggttcggaaagccagtacagaaggcattgctatccagggtcag
cagggagcacgactactacctgagcagctcatctctgaagccttcatccttagtgacctt
tttgaccttggagaactagccgccctcgagctgctgctggcaggagagcatcagcagcct
catttccccggcctgacccgaggcctggtagctgtgctcctttactgggatggtaaacgc
tgcgtggccaactctctccgctcacttatccagtccagacatgggaagactttcactctt
gacttgagtcctgaattggtgaatctcaccacacggttcacagatgagctgatggcccag
ggtttgaccaagcaaatactgaacctggtctctgacgtcagcgtgacccgtgagtttgag
aggctgcagaaagagcgtggccttggcaatgagaaacacaggaaagaggtatctgacctc
attaaagagtgccgacagtctctggcagagtgtttgtttgcgtgggcatgccagtcaccg
ctaggcaaagatgacacgctggctcttattgggcatttagagatggtgaccgctgaagct
gatggctctttggatagtgtcaaccttgctttggtcatggcattgctctattccctggat
gttagttttctggagcaaggaacagaagatagagaagacctgctccaggctttgcctctg
ttgacggagaaacagtacgtggcagccgtgcacagtcggctggttgagggtcaaggctgg
aagcttccaggactgcaggcagtggtgcagctggcctgggcgctgtctctgagggccctt
tcacaacttccacagggtgcagctttagtggagttcacagaagcagatgaggctctggcg
gaccaggcactgttgggaggcgtcttcctctttctgacggagggcgtcctgggaagtgat
ggtttcagccaagaagaattttacactcggcggctgcattctctgattactgatttcctg
gcactcatgccaatgaaggtgaaacagttgcgcaaccgtgccgatgaagatgctcgtctg
atccacatggctctgcagatgggcagcgagccgccatcatctcttcgcaaggacctggac
cacctcatgatccttattggagaattttacagcaaagatccatttgaacttgagctggct
ttagagttttggtgtccatcagagtctcttcagcacacttcactcactggatcttttctt
ggagtacctctccaaagacccccacataaacaggtggttctctccaagtttgtgcgtcag
atgggtgatctgcttcctgcgactctttacatcccatacctgcgaatgctgaaaggactt
gcaaatggccctcagtgctcccactactgcttcagtctgcttaaaactaacggcgctcca
cacggagagaaccggcaggctggagtgtcaggcagtcttgtgtcatgggaacactttttc
cactcgctcatgctgtaccatgaaaacctgcgacgagacgtgcccagtgccgacagcaca
caataccgtcatctaccaatcagaggcatcactcagagagagctggaaggtctcactgca
ttcctccagctgctcaccacgatcatcacctggagtgagaatgcacgtctggctctttgt
gagcaccctcagtggacccctgtggtggtgatgctgggtttgctacagtgtagtgttcag
cccgtcctcaaagctcaagtccttcatgttctcgctgcttttggcaaatctcctgagatt
gcagcctccctctggcagtctctagagtacacacagatcctacaaacagtgaaaatccct
ggtcagagacaggctgctgggatcgaggtggagctgaatgagattgaatcgagctgtgag
gagtatccactcacacgggccttttgtcatctgatcagtactctggtggagagcgcactt
ccagtcaatcttggagcaggactgcgagctcccggcttccaaccttatcttgacttcctg
cgtgactctgtgtttctggccttccccacgcgagcctaccgtcgctcagcagaaaagtgg
gaggtagctgaagcagtgctagaggtttttcacaaacttctgcgagaatatgagccccag
ccttcagacttcctgccggagatggtggaacttcaaggagagcaggtgccggcccataag
cccccggggcacagcctgatgttccaccttttgaacgactcacccaccctctctctctgc
ctcaacctactggaggagggcgcccgccagcttgacacatacgctcaattccctggcaag
aagcagttagagtctgcagttctgcactgtctgtgtttgctggagctagccctgcagaag
gaggtgacgttcatggatctgctgagagaaagtcaaacatcacttcttgtgtctcctttg
gagcagctcctgcagggcgtcagtgctcagagcagaaaggcagatcacatcaccaacatt
gctaggtacctgtatcacagcagctccaatcctgatgctgcgttccagagtgcaaagatc
ctgcgacggatcactcgctacccaaacatccaggccagactggttggagacttcactcat
gatcaggcagtgagtgagaggttgatggccggctttgtggagtgtctggacagtgaagag
gctcaggaaggagtgaccacaaatgattcagactctgagaaacgggtggccagaattcgt
catgagaccaagatccacatcttgaatcttttgatcacgtccctggagctaacaggcccc
aatctgggcctgtatctgcttggctatgaagtcaagaagccagtttcctccactaacctt
caagacccaggtgttcttggctgtccgcggagctgcctgcatgcgattctcagtctgctt
cagaggggcagtgactctcgctctggacctgggctcattaaacaggctcctcaactagct
gaactctgctaccaggtgatttatcagctgtgcgcatgtcctgacacctctggcccaacc
atgagatacctcaggaccagtcaggacttcctgttctctcatctgcaacacctacctttc
gttttatcagaaaatgagatcgcggctctgtctcagatgtcctggctaatgaaaaccaca
gcaatcgagctccgagtgacctcactgaaccgccagcgctcacacacacagagactcctg
aacctcctcctcgatgaccagccacacacattacacacagcagatggagagaccggcatg
gaggaggagaacagatcagtcagtggttttctgcagtttggcaccgtctccaaggtgcgc
aggaggctgctcagtgttttggatgccatagatttcagtcaggaggcaccagagcttctg
cagctggacttctttgagcgcactcagatcgagcaggtcatcactaactgtgaacatgtc
aacgagcagggacacaccgtctgcaatgtcaagttgctgcatcgagttttagttgcagag
atcaatgcactacagggcatggcagccatcgggcaaagaccactgctaatggaggaggtg
aattcagtcctgcagcaggtggtggagaggaatcgcgtgcggcgcagtctcagtgccaag
cgtcatgctctgcagagctggaggagtctggtggagaccatcctcaccgcctgtccttca
gaactcatccctgcagaccagcggcagctcatcatcagagatctgctgcttgacctgcat
gacaaggtgttatcagaagatgctgctggtgaactgatgccaatcgtagccggagcagtc
ttcacattaacagcacaccttagccaatcagtgctctctgaacagcagggggtggggcca
gagggtggctctggatcaggatttgcatccattgctaactccgcccttcacctcatcctg
aggaagctgctggactttatcttgtgcacaggtggaggctttcagcgtctcagggctcat
ttgtatggagctctgctgtactacctgcagatcgcccagaaacctgaggagccagagaca
ctgcagacaggcacatccatgtgggagcgtttgactgcccctgaagattgcttctccaag
ctacagagagaaaacctgtccatcatcgagagctatggcactgcgctaatggaagtggtg
tgcagagacgcttgtgatggccatgagatcggccgaatgctggctctggccgtgttagac
agggtgttgtctatagacaggcagtgtcagtggctggtgtacttgtgtaacagtggttac
ctgcgtgtgctggtggagagtttaaagcaggatgacgtttctttgcaaactcttctcacg
cctcagccgccgctgcttaaaccgttgtacatctacgagtccaaaatggctctgctgacc
cgcgtggccaagaccgctcagggtgcgatggagctgctgcgctgtggtctggtcgctcag
ctggtggagtgtcaggtgtttcacatgctccctcagaatgacgcgctcagagtgtttggg
cagagagatccttcagggtttattcctagtcctctggagcgatacaggcagatcctgctt
cctacactcagactgatgcaggtcatcttgacctccaccaccgcacagcaccagcagggg
gcagcacaggtgctccagtggcttatcgttcattcggatgtcattcagtctattctgcat
ggtcaggacatgagcatgggctctttacaggaactgtctctgctcactgccatcatcagc
aagacggcactgccaggagcacttgagatgggacaggaaatcaacagcgctgccctcatg
gagttacagggacacatcggcagattccagcggcagtcgttgtctctgctggtgcgtctg
gtgggcactgatcgcgctcgctaccttaagcagattgaggacaccgtttctcccagcaac
ctagcagaaaaaagagaggaaatggaggttgccatgcaacagatctgtgctaatattatg
gagtactgccagacgctgctgctgcagagctcatctgaagcccagttctcactctgtctg
ttcagcccatcagcaagtgaaccagccgatgtgtccatcccctctgcccgcgtgcccagt
ctggggctggttctgctcctgctgaaaaacagcgccagcgacttcttcaggtatcacgac
agtcacagacagagcctgaacaagctggagcgagtggagcagcttcctcctgaggaactc
aaagagctgtgccagggtttggtgtctggttctggtggagtggaaaagatctcatcagtg
cagagaaacgtactcgccaaacggagactcgtccagctggtcaacaacagagccaagctt
cttgccctctgctcttatatcattgagacgtgtctgtttgtcatctggcgccacctagag
ttttacttgctttactgcactcccactgaccccaaagactcactgctgccaggttacaga
gatcctgcaggcagcagaggattgagcgtgtcgagagtgagccagcaagatcttgaacag
ttgcagagtgacatgtcgagcagcttcagtgagccgctgcagaggaagctgctggaggtg
gagggactttatagcaaaagccgctctcgtcacaccttcatccaggccctgacacgcagg
atccgcggcctcgtacaccacgccaaaagctga

DBGET integrated database retrieval system