KEGG   Danio rerio (zebrafish): 445382Help
Entry
445382            CDS       T01004                                 

Gene name
nup205
Definition
(RefSeq) nuclear pore complex protein Nup205
  KO
K14310  
nuclear pore complex protein Nup205
Organism
dre  Danio rerio (zebrafish)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    445382 (nup205)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     445382 (nup205)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    445382 (nup205)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
Position
18
AA seq 1970 aa AA seqDB search
MATQMAVNSGASLWGPLKELWEAVEGAIWRRQPESVHLLDLQLKKHKPYFLNLFKNPPKS
AEQREKVRKASTEGIAIQGQQGARLLPEQLISEAFILSDLFDLGELAALELLLAGEHQQP
HFPGLTRGLVAVLLYWDGKRCVANSLRSLIQSRHGKTFTLDLSPELVNLTTRFTDELMAQ
GLTKQILNLVSDVSVTREFERLQKERGLGNEKHRKEVSDLIKECRQSLAECLFAWACQSP
LGKDDTLALIGHLEMVTAEADGSLDSVNLALVMALLYSLDVSFLEQGTEDREDLLQALPL
LTEKQYVAAVHSRLVEGQGWKLPGLQAVVQLAWALSLRALSQLPQGAALVEFTEADEALA
DQALLGGVFLFLTEGVLGSDGFSQEEFYTRRLHSLITDFLALMPMKVKQLRNRADEDARL
IHMALQMGSEPPSSLRKDLDHLMILIGEFYSKDPFELELALEFWCPSESLQHTSLTGSFL
GVPLQRPPHKQVVLSKFVRQMGDLLPATLYIPYLRMLKGLANGPQCSHYCFSLLKTNGAP
HGENRQAGVSGSLVSWEHFFHSLMLYHENLRRDVPSADSTQYRHLPIRGITQRELEGLTA
FLQLLTTIITWSENARLALCEHPQWTPVVVMLGLLQCSVQPVLKAQVLHVLAAFGKSPEI
AASLWQSLEYTQILQTVKIPGQRQAAGIEVELNEIESSCEEYPLTRAFCHLISTLVESAL
PVNLGAGLRAPGFQPYLDFLRDSVFLAFPTRAYRRSAEKWEVAEAVLEVFHKLLREYEPQ
PSDFLPEMVELQGEQVPAHKPPGHSLMFHLLNDSPTLSLCLNLLEEGARQLDTYAQFPGK
KQLESAVLHCLCLLELALQKEVTFMDLLRESQTSLLVSPLEQLLQGVSAQSRKADHITNI
ARYLYHSSSNPDAAFQSAKILRRITRYPNIQARLVGDFTHDQAVSERLMAGFVECLDSEE
AQEGVTTNDSDSEKRVARIRHETKIHILNLLITSLELTGPNLGLYLLGYEVKKPVSSTNL
QDPGVLGCPRSCLHAILSLLQRGSDSRSGPGLIKQAPQLAELCYQVIYQLCACPDTSGPT
MRYLRTSQDFLFSHLQHLPFVLSENEIAALSQMSWLMKTTAIELRVTSLNRQRSHTQRLL
NLLLDDQPHTLHTADGETGMEEENRSVSGFLQFGTVSKVRRRLLSVLDAIDFSQEAPELL
QLDFFERTQIEQVITNCEHVNEQGHTVCNVKLLHRVLVAEINALQGMAAIGQRPLLMEEV
NSVLQQVVERNRVRRSLSAKRHALQSWRSLVETILTACPSELIPADQRQLIIRDLLLDLH
DKVLSEDAAGELMPIVAGAVFTLTAHLSQSVLSEQQGVGPEGGSGSGFASIANSALHLIL
RKLLDFILCTGGGFQRLRAHLYGALLYYLQIAQKPEEPETLQTGTSMWERLTAPEDCFSK
LQRENLSIIESYGTALMEVVCRDACDGHEIGRMLALAVLDRVLSIDRQCQWLVYLCNSGY
LRVLVESLKQDDVSLQTLLTPQPPLLKPLYIYESKMALLTRVAKTAQGAMELLRCGLVAQ
LVECQVFHMLPQNDALRVFGQRDPSGFIPSPLERYRQILLPTLRLMQVILTSTTAQHQQG
AAQVLQWLIVHSDVIQSILHGQDMSMGSLQELSLLTAIISKTALPGALEMGQEINSAALM
ELQGHIGRFQRQSLSLLVRLVGTDRARYLKQIEDTVSPSNLAEKREEMEVAMQQICANIM
EYCQTLLLQSSSEAQFSLCLFSPSASEPADVSIPSARVPSLGLVLLLLKNSASDFFRYHD
SHRQSLNKLERVEQLPPEELKELCQGLVSGSGGVEKISSVQRNVLAKRRLVQLVNNRAKL
LALCSYIIETCLFVIWRHLEFYLLYCTPTDPKDSLLPGYRDPAGSRGLSVSRVSQQDLEQ
LQSDMSSSFSEPLQRKLLEVEGLYSKSRSRHTFIQALTRRIRGLVHHAKS
NT seq 5913 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcagatggcggtaaattcaggagccagtctgtgggggccgctgaaggagctc
tgggaggctgtggaaggggccatttggagacgtcaaccagaaagtgttcatcttttagat
ctgcagttgaagaaacacaaaccctacttcctcaacctctttaaaaacccaccgaagagt
gcagaacagagagagaaggttcggaaagccagtacagaaggcattgctatccagggtcag
cagggagcacgactactacctgagcagctcatctctgaagccttcatccttagtgacctt
tttgaccttggagaactagccgccctcgagctgctgctggcaggagagcatcagcagcct
catttccccggcctgacccgaggcctggtagctgtgctcctttactgggatggtaaacgc
tgcgtggccaactctctccgctcacttatccagtccagacatgggaagactttcactctt
gacttgagtcctgaattggtgaatctcaccacacggttcacagatgagctgatggcccag
ggtttgaccaagcaaatactgaacctggtctctgacgtcagcgtgacccgtgagtttgag
aggctgcagaaagagcgtggccttggcaatgagaaacacaggaaagaggtatctgacctc
attaaagagtgccgacagtctctggcagagtgtttgtttgcgtgggcatgccagtcaccg
ctaggcaaagatgacacgctggctcttattgggcatttagagatggtgaccgctgaagct
gatggctctttggatagtgtcaaccttgctttggtcatggcattgctctattccctggat
gttagttttctggagcaaggaacagaagatagagaagacctgctccaggctttgcctctg
ttgacggagaaacagtacgtggcagccgtgcacagtcggctggttgagggtcaaggctgg
aagcttccaggactgcaggcagtggtgcagctggcctgggcgctgtctctgagggccctt
tcacaacttccacagggtgcagctttagtggagttcacagaagcagatgaggctctggcg
gaccaggcactgttgggaggcgtcttcctctttctgacggagggcgtcctgggaagtgat
ggtttcagccaagaagaattttacactcggcggctgcattctctgattactgatttcctg
gcactcatgccaatgaaggtgaaacagttgcgcaaccgtgccgatgaagatgctcgtctg
atccacatggctctgcagatgggcagcgagccgccatcatctcttcgcaaggacctggac
cacctcatgatccttattggagaattttacagcaaagatccatttgaacttgagctggct
ttagagttttggtgtccatcagagtctcttcagcacacttcactcactggatcttttctt
ggagtacctctccaaagacccccacataaacaggtggttctctccaagtttgtgcgtcag
atgggtgatctgcttcctgcgactctttacatcccatacctgcgaatgctgaaaggactt
gcaaatggccctcagtgctcccactactgcttcagtctgcttaaaactaacggcgctcca
cacggagagaaccggcaggctggagtgtcaggcagtcttgtgtcatgggaacactttttc
cactcgctcatgctgtaccatgaaaacctgcgacgagacgtgcccagtgccgacagcaca
caataccgtcatctaccaatcagaggcatcactcagagagagctggaaggtctcactgca
ttcctccagctgctcaccacgatcatcacctggagtgagaatgcacgtctggctctttgt
gagcaccctcagtggacccctgtggtggtgatgctgggtttgctacagtgtagtgttcag
cccgtcctcaaagctcaagtccttcatgttctcgctgcttttggcaaatctcctgagatt
gcagcctccctctggcagtctctagagtacacacagatcctacaaacagtgaaaatccct
ggtcagagacaggctgctgggatcgaggtggagctgaatgagattgaatcgagctgtgag
gagtatccactcacacgggccttttgtcatctgatcagtactctggtggagagcgcactt
ccagtcaatcttggagcaggactgcgagctcccggcttccaaccttatcttgacttcctg
cgtgactctgtgtttctggccttccccacgcgagcctaccgtcgctcagcagaaaagtgg
gaggtagctgaagcagtgctagaggtttttcacaaacttctgcgagaatatgagccccag
ccttcagacttcctgccggagatggtggaacttcaaggagagcaggtgccggcccataag
cccccggggcacagcctgatgttccaccttttgaacgactcacccaccctctctctctgc
ctcaacctactggaggagggcgcccgccagcttgacacatacgctcaattccctggcaag
aagcagttagagtctgcagttctgcactgtctgtgtttgctggagctagccctgcagaag
gaggtgacgttcatggatctgctgagagaaagtcaaacatcacttcttgtgtctcctttg
gagcagctcctgcagggcgtcagtgctcagagcagaaaggcagatcacatcaccaacatt
gctaggtacctgtatcacagcagctccaatcctgatgctgcgttccagagtgcaaagatc
ctgcgacggatcactcgctacccaaacatccaggccagactggttggagacttcactcat
gatcaggcagtgagtgagaggttgatggccggctttgtggagtgtctggacagtgaagag
gctcaggaaggagtgaccacaaatgattcagactctgagaaacgggtggccagaattcgt
catgagaccaagatccacatcttgaatcttttgatcacgtccctggagctaacaggcccc
aatctgggcctgtatctgcttggctatgaagtcaagaagccagtttcctccactaacctt
caagacccaggtgttcttggctgtccgcggagctgcctgcatgcgattctcagtctgctt
cagaggggcagtgactctcgctctggacctgggctcattaaacaggctcctcaactagct
gaactctgctaccaggtgatttatcagctgtgcgcatgtcctgacacctctggcccaacc
atgagatacctcaggaccagtcaggacttcctgttctctcatctgcaacacctacctttc
gttttatcagaaaatgagatcgcggctctgtctcagatgtcctggctaatgaaaaccaca
gcaatcgagctccgagtgacctcactgaaccgccagcgctcacacacacagagactcctg
aacctcctcctcgatgaccagccacacacattacacacagcagatggagagaccggcatg
gaggaggagaacagatcagtcagtggttttctgcagtttggcaccgtctccaaggtgcgc
aggaggctgctcagtgttttggatgccatagatttcagtcaggaggcaccagagcttctg
cagctggacttctttgagcgcactcagatcgagcaggtcatcactaactgtgaacatgtc
aacgagcagggacacaccgtctgcaatgtcaagttgctgcatcgagttttagttgcagag
atcaatgcactacagggcatggcagccatcgggcaaagaccactgctaatggaggaggtg
aattcagtcctgcagcaggtggtggagaggaatcgcgtgcggcgcagtctcagtgccaag
cgtcatgctctgcagagctggaggagtctggtggagaccatcctcaccgcctgtccttca
gaactcatccctgcagaccagcggcagctcatcatcagagatctgctgcttgacctgcat
gacaaggtgttatcagaagatgctgctggtgaactgatgccaatcgtagccggagcagtc
ttcacattaacagcacaccttagccaatcagtgctctctgaacagcagggggtggggcca
gagggtggctctggatcaggatttgcatccattgctaactccgcccttcacctcatcctg
aggaagctgctggactttatcttgtgcacaggtggaggctttcagcgtctcagggctcat
ttgtatggagctctgctgtactacctgcagatcgcccagaaacctgaggagccagagaca
ctgcagacaggcacatccatgtgggagcgtttgactgcccctgaagattgcttctccaag
ctacagagagaaaacctgtccatcatcgagagctatggcactgcgctaatggaagtggtg
tgcagagacgcttgtgatggccatgagatcggccgaatgctggctctggccgtgttagac
agggtgttgtctatagacaggcagtgtcagtggctggtgtacttgtgtaacagtggttac
ctgcgtgtgctggtggagagtttaaagcaggatgacgtttctttgcaaactcttctcacg
cctcagccgccgctgcttaaaccgttgtacatctacgagtccaaaatggctctgctgacc
cgcgtggccaagaccgctcagggtgcgatggagctgctgcgctgtggtctggtcgctcag
ctggtggagtgtcaggtgtttcacatgctccctcagaatgacgcgctcagagtgtttggg
cagagagatccttcagggtttattcctagtcctctggagcgatacaggcagatcctgctt
cctacactcagactgatgcaggtcatcttgacctccaccaccgcacagcaccagcagggg
gcagcacaggtgctccagtggcttatcgttcattcggatgtcattcagtctattctgcat
ggtcaggacatgagcatgggctctttacaggaactgtctctgctcactgccatcatcagc
aagacggcactgccaggagcacttgagatgggacaggaaatcaacagcgctgccctcatg
gagttacagggacacatcggcagattccagcggcagtcgttgtctctgctggtgcgtctg
gtgggcactgatcgcgctcgctaccttaagcagattgaggacaccgtttctcccagcaac
ctagcagaaaaaagagaggaaatggaggttgccatgcaacagatctgtgctaatattatg
gagtactgccagacgctgctgctgcagagctcatctgaagcccagttctcactctgtctg
ttcagcccatcagcaagtgaaccagccgatgtgtccatcccctctgcccgcgtgcccagt
ctggggctggttctgctcctgctgaaaaacagcgccagcgacttcttcaggtatcacgac
agtcacagacagagcctgaacaagctggagcgagtggagcagcttcctcctgaggaactc
aaagagctgtgccagggtttggtgtctggttctggtggagtggaaaagatctcatcagtg
cagagaaacgtactcgccaaacggagactcgtccagctggtcaacaacagagccaagctt
cttgccctctgctcttatatcattgagacgtgtctgtttgtcatctggcgccacctagag
ttttacttgctttactgcactcccactgaccccaaagactcactgctgccaggttacaga
gatcctgcaggcagcagaggattgagcgtgtcgagagtgagccagcaagatcttgaacag
ttgcagagtgacatgtcgagcagcttcagtgagccgctgcagaggaagctgctggaggtg
gagggactttatagcaaaagccgctctcgtcacaccttcatccaggccctgacacgcagg
atccgcggcctcgtacaccacgccaaaagctga

DBGET integrated database retrieval system