KEGG   Danio rerio (zebrafish): 447814Help
Entry
447814            CDS       T01004                                 

Gene name
ppp3r1b, zgc:92169
Definition
protein phosphatase 3 (formerly 2B), regulatory s1ubunit B, alpha isoform, b
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Wnt signaling pathway
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    447814 (ppp3r1b)
   04310 Wnt signaling pathway
    447814 (ppp3r1b)
   04370 VEGF signaling pathway
    447814 (ppp3r1b)
   04020 Calcium signaling pathway
    447814 (ppp3r1b)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    447814 (ppp3r1b)
   04210 Apoptosis
    447814 (ppp3r1b)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     447814 (ppp3r1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
1
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaggcgagttatcccttggagatgtgctcacactttgacgctgatgagatt
aaaagactaggaaagcggtttaagaaactcgacctggataactcgggctctctcagcgtg
gaggagttcatgtctctgcccgaactgcaacagaatccgctggtgcagcgagtcatcgac
atattcgacacagatggaaacggagaagtcgactttaaagagttcattgaaggcgtttct
cagttcagtgtgaagggcgacaaggagcagaagctccgctttgcgttcaggatttacgac
atggacaaagatggctacatctccaacggcgagctgttccaggtgctgaagatgatggtg
gggaataacctgaaggacactcaactgcagcagatcgtcgacaaaaccatcatcaacgca
gacaaggacggtgacggcaggatatccttcgaggagttctgcgctgttgttggcggttta
gacattcataaaaagatggtggtggacgtgtga

DBGET integrated database retrieval system