KEGG   Danio rerio (zebrafish): 447833Help
Entry
447833            CDS       T01004                                 

Gene name
hat1, zgc:92639
Definition
histone acetyltransferase 1 (EC:2.3.1.48)
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     447833 (hat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
9
AA seq 408 aa AA seqDB search
MAAVNDMEKKLAEYKCDTNEAICLKLVRFPEDIDDESTTFHPEFSHQLFGDDEVAFGYKG
LQIQLYQSAGNLNTLFKVKYTARVTDKFDCVEPDDVEGKIREIIPAGFCCNTDDFISVLE
KEANFKPFGSLQHTYKVHNVEAGEDLTYQIHKVDISCPGFREYHERLQTFLMWFIETASF
IDVDDDRWDFFLVFEKYNKDGETLYATVGYMTVYNYYVYPDKTRPRVSQMLILPPFQGEG
HGAQLLETVHRYYCTSPKVQDITAEDPSENYVKLRDFVLVKLCLTLPSFASEKLSQGFSE
EMASEAREKLKINKKHARRVYEILRLRNTDMNDEKKAREFRLEVKKRLFGPYRKNQRELT
KMRKCLRPEELASHISQMDTTLQHEELEKSYQDVVAEYRRVLERLAQV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgtgaatgacatggagaagaagcttgcggagtataaatgcgacaccaatgaa
gccatatgtctaaaattggtgaggttcccggaggatatagatgatgaaagcacaacattt
cacccggagttcagtcatcagctgtttggagatgatgaagtggcgtttggctacaagggt
cttcagatccagctttaccagagcgcaggaaacctcaacaccctgtttaaagtcaagtac
actgccagagtcacagacaagtttgactgcgttgagccagatgatgtggagggtaaaatc
cgagagatcattcctgctggtttctgctgtaacacagacgacttcatctctgtcctggag
aaagaggccaactttaaacccttcggcagcctgcagcacacctacaaagttcacaatgtg
gaggcaggagaggatctcacctaccagatacacaaggtggacatctcatgtccaggcttc
agagaataccacgagcgcttacagacatttctcatgtggttcatcgagacggccagtttc
atcgatgtggatgacgatcgctgggatttcttcctcgtattcgagaagtacaataaggac
ggagagaccctctacgcaacggttggctacatgacagtgtataattactacgtataccca
gacaaaaccagaccacgtgtcagccagatgctgatcttaccacctttccagggagaaggc
cacggggctcagctgttggagaccgtccacagatactactgcacatctcctaaagtgcag
gacatcacagcggaagatccatctgaaaactatgtgaagctgagggactttgtgctggtg
aagctctgcttgactctgccgtcatttgccagcgagaaactttcccagggtttcagtgaa
gagatggcatctgaggccagagagaaactcaagatcaacaagaaacatgcacgacgtgtt
tatgagattctgcgtctccgaaatacagacatgaacgatgagaagaaagcccgagagttt
cgcttggaggtgaaaaagcggctcttcggaccctacagaaagaaccagcgtgagctgacg
aagatgcgtaaatgtttgagacccgaggagctggcgtcccacatcagccagatggacaca
acgctgcagcacgaggaactggagaaaagctaccaggacgtggtggctgaatatcgcaga
gtcctggagcgactggctcaagtgtga

DBGET integrated database retrieval system