KEGG   Danio rerio (zebrafish): 447836Help
Entry
447836            CDS       T01004                                 

Gene name
pfkma, pfkm, zgc:92344
Definition
phosphofructokinase, muscle a (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    447836 (pfkma)
   01230 Biosynthesis of amino acids
    447836 (pfkma)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    447836 (pfkma)
   00030 Pentose phosphate pathway
    447836 (pfkma)
   00051 Fructose and mannose metabolism
    447836 (pfkma)
   00052 Galactose metabolism
    447836 (pfkma)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    447836 (pfkma)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     447836 (pfkma)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     447836 (pfkma)
Messenger RNA biogenesis [BR:dre03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     447836 (pfkma)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
23
AA seq 784 aa AA seqDB search
MANINTTEVDPTKMGVGRAIAVLTSGGDAQGMNAAVRATVRVGLYTGAKVFFVHEGYQGL
VDGGDHIRPATWESVSMMLQLGGTVIGSARCKDFQTREGRLKAAYNLVKLGITNLCVIGG
DGSLTGANIFRTEWSDLLKDHVSKGKITKEEAKASSHLNIVGMVGSIDNDFCGTDMTIGT
DSALHRIIEVVDSITTTAQSHQRAFILEVMGRHCGYLALVTALACGADWVFIPEMPPDDG
WEEHLCRRLTETRNAGSRLNVIIVAEGAINKEGQPITCDQLKDLVTKRLGFDTRATILGH
VQRGGTPSAFDRVLGSRMGVEAVMALLEATPETPACVVSLTGNQAVRLPLMECVQVTKDV
TIAMNEGRFDDAVKLRGRSFENNWNTYKLLAHIRPPDKKSNINVAILNVGAPCAGMNAAV
RAAVRIGIIQGHNMLAVHDGFEGLAQAKIEPITWNTVGDWTGKGGSDLGTKRLLPGKYME
EISLNIAKYNIHALVIIGGFEAFSGGLEMVQGREKYEELCIPMVIIPATVSNNVPGSDFS
IGADTALNTITTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMSGLSAGADAAYIFEEK
FGIRDLERNVEHLVEKMKTTVKRGLILRNENSNSNYTTDFIFNLYSEEGKGVFDCRKNVL
GHMQQGGTPTPFDRNFATKMGAKAVLWLTEKLKDCYRHGRIFANTPDSACVLGMRKRGLV
LQPLAELKEETDFEHRIPKSQWWLKLRPIMKILAKYKINLDTSEHALMEHVVSKKPPVHM
TLTK
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggctaacataaacacgactgaggtggatccaacaaagatgggggtcggacgggccatc
gctgtgctgacgtcaggtggtgatgcccaggggatgaatgcagctgtgagggccactgtc
agagttggtctttacactggagctaaagtcttcttcgtccatgagggctatcagggattg
gttgatggaggggatcacatccgtcctgctacatgggagagtgtgtccatgatgctgcag
ctgggtgggacagtaattggcagcgcccgctgtaaggatttccagaccagagaagggcgt
ttaaaggctgcatacaatcttgtcaaattaggcatcactaacctctgtgtaatcggcggt
gatggcagtctgaccggtgccaacatatttcgcactgagtggagtgacttgctgaaagat
catgtcagcaaaggtaagatcaccaaggaagaggccaaagcttcatctcatctgaatatt
gtgggtatggttggctccatagacaatgacttttgtggaacggacatgactattggcaca
gactcggccctgcatcgcatcattgaggtggtggacagtatcaccacaacagcacaaagc
caccaacgtgcgtttatcctggaggtcatgggcagacactgtggctatctagcactggtt
actgctcttgcatgtggtgccgactgggtgtttattccagagatgcctccagatgatggc
tgggaggagcacttgtgcagaagactaacagagaccagaaatgcaggttctcgtctcaat
gtgatcatcgtggctgagggagccatcaataaagaaggacaaccaatcacctgtgaccag
ctgaaagatctggtgacaaagaggctgggctttgacactcgtgccactattcttggacac
gtgcagagaggtggaaccccttcagcttttgacagagtcctaggcagtcggatgggtgtg
gaggctgtaatggctctgctggaagccactccagagacccctgcgtgtgtggtcagtctg
accgggaaccaggctgttagactccccctgatggagtgtgtacaagtgaccaaggatgtc
actattgcaatgaatgagggtcgattcgatgatgctgtaaagctcaggggaaggagtttt
gagaataactggaacacatataagcttttggctcatattcgccccccagataagaagagt
aacattaatgtggccatcctgaacgtgggtgctccctgcgctggcatgaacgcagctgtg
cgtgcagctgtcaggatcggcatcatccaaggccacaacatgctggcggtccatgatggc
tttgagggtctggctcaagcaaagattgagcctatcacctggaacactgttggagattgg
acagggaaaggaggatctgacttgggaactaaaagactattgcctggaaaatacatggag
gagatcagcctgaatattgccaagtataatattcacgctctggttatcatcggtggtttt
gaggcattttcaggtggactggaaatggttcaaggcagagaaaagtatgaagagctgtgt
attcctatggtgatcattcctgctactgtatcaaacaacgtgcccggctcagacttcagc
attggagcagacactgcccttaataccatcaccacgacctgtgacaggatcaagcagtcg
gcagcaggaactaagcgacgtgtgttcatcattgaaactatgggaggatactgcggttac
ctggccacaatgtctggtctctctgccggagctgatgctgcttacatattcgaggagaaa
tttggcattcgtgacctagagagaaatgtggaacatcttgttgagaagatgaaaaccact
gttaagagaggcctaattctcagaaatgagaacagcaattccaactacaccaccgatttc
atcttcaacctgtattcagaggaagggaaaggtgtttttgactgccgtaagaatgtcctt
ggccatatgcagcagggtggcaccccaacaccttttgatagaaactttgctaccaaaatg
ggtgccaaggctgttctctggctgacagaaaaactgaaggattgttatagacatgggcga
atctttgccaacaccccagactctgcatgtgtgttaggcatgaggaagagaggactggtg
ttacagcctctagctgaattgaaagaagagaccgattttgaacaccgtataccaaagagc
cagtggtggttaaagctgaggcctattatgaagatcctggccaagtacaagattaatctg
gacacctctgaacatgctctaatggagcacgttgtcagcaagaagcctccggtgcacatg
accctcacaaagtaa

DBGET integrated database retrieval system