KEGG   Danio rerio (zebrafish): 447836Help
Entry
447836            CDS       T01004                                 

Gene name
pfkma, pfkm, zgc:92344
Definition
phosphofructokinase, muscle a (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:dre01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dre01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dre00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dre00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dre00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dre00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
23
AA seq 784 aa AA seqDB search
MANINTTEVDPTKMGVGRAIAVLTSGGDAQGMNAAVRATVRVGLYTGAKVFFVHEGYQGL
VDGGDHIRPATWESVSMMLQLGGTVIGSARCKDFQTREGRLKAAYNLVKLGITNLCVIGG
DGSLTGANIFRTEWSDLLKDHVSKGKITKEEAKASSHLNIVGMVGSIDNDFCGTDMTIGT
DSALHRIIEVVDSITTTAQSHQRAFILEVMGRHCGYLALVTALACGADWVFIPEMPPDDG
WEEHLCRRLTETRNAGSRLNVIIVAEGAINKEGQPITCDQLKDLVTKRLGFDTRATILGH
VQRGGTPSAFDRVLGSRMGVEAVMALLEATPETPACVVSLTGNQAVRLPLMECVQVTKDV
TIAMNEGRFDDAVKLRGRSFENNWNTYKLLAHIRPPDKKSNINVAILNVGAPCAGMNAAV
RAAVRIGIIQGHNMLAVHDGFEGLAQAKIEPITWNTVGDWTGKGGSDLGTKRLLPGKYME
EISLNIAKYNIHALVIIGGFEAFSGGLEMVQGREKYEELCIPMVIIPATVSNNVPGSDFS
IGADTALNTITTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMSGLSAGADAAYIFEEK
FGIRDLERNVEHLVEKMKTTVKRGLILRNENSNSNYTTDFIFNLYSEEGKGVFDCRKNVL
GHMQQGGTPTPFDRNFATKMGAKAVLWLTEKLKDCYRHGRIFANTPDSACVLGMRKRGLV
LQPLAELKEETDFEHRIPKSQWWLKLRPIMKILAKYKINLDTSEHALMEHVVSKKPPVHM
TLTK
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggctaacataaacacgactgaggtggatccaacaaagatgggggtcggacgggccatc
gctgtgctgacgtcaggtggtgatgcccaggggatgaatgcagctgtgagggccactgtc
agagttggtctttacactggagctaaagtcttcttcgtccatgagggctatcagggattg
gttgatggaggggatcacatccgtcctgctacatgggagagtgtgtccatgatgctgcag
ctgggtgggacagtaattggcagcgcccgctgtaaggatttccagaccagagaagggcgt
ttaaaggctgcatacaatcttgtcaaattaggcatcactaacctctgtgtaatcggcggt
gatggcagtctgaccggtgccaacatatttcgcactgagtggagtgacttgctgaaagat
catgtcagcaaaggtaagatcaccaaggaagaggccaaagcttcatctcatctgaatatt
gtgggtatggttggctccatagacaatgacttttgtggaacggacatgactattggcaca
gactcggccctgcatcgcatcattgaggtggtggacagtatcaccacaacagcacaaagc
caccaacgtgcgtttatcctggaggtcatgggcagacactgtggctatctagcactggtt
actgctcttgcatgtggtgccgactgggtgtttattccagagatgcctccagatgatggc
tgggaggagcacttgtgcagaagactaacagagaccagaaatgcaggttctcgtctcaat
gtgatcatcgtggctgagggagccatcaataaagaaggacaaccaatcacctgtgaccag
ctgaaagatctggtgacaaagaggctgggctttgacactcgtgccactattcttggacac
gtgcagagaggtggaaccccttcagcttttgacagagtcctaggcagtcggatgggtgtg
gaggctgtaatggctctgctggaagccactccagagacccctgcgtgtgtggtcagtctg
accgggaaccaggctgttagactccccctgatggagtgtgtacaagtgaccaaggatgtc
actattgcaatgaatgagggtcgattcgatgatgctgtaaagctcaggggaaggagtttt
gagaataactggaacacatataagcttttggctcatattcgccccccagataagaagagt
aacattaatgtggccatcctgaacgtgggtgctccctgcgctggcatgaacgcagctgtg
cgtgcagctgtcaggatcggcatcatccaaggccacaacatgctggcggtccatgatggc
tttgagggtctggctcaagcaaagattgagcctatcacctggaacactgttggagattgg
acagggaaaggaggatctgacttgggaactaaaagactattgcctggaaaatacatggag
gagatcagcctgaatattgccaagtataatattcacgctctggttatcatcggtggtttt
gaggcattttcaggtggactggaaatggttcaaggcagagaaaagtatgaagagctgtgt
attcctatggtgatcattcctgctactgtatcaaacaacgtgcccggctcagacttcagc
attggagcagacactgcccttaataccatcaccacgacctgtgacaggatcaagcagtcg
gcagcaggaactaagcgacgtgtgttcatcattgaaactatgggaggatactgcggttac
ctggccacaatgtctggtctctctgccggagctgatgctgcttacatattcgaggagaaa
tttggcattcgtgacctagagagaaatgtggaacatcttgttgagaagatgaaaaccact
gttaagagaggcctaattctcagaaatgagaacagcaattccaactacaccaccgatttc
atcttcaacctgtattcagaggaagggaaaggtgtttttgactgccgtaagaatgtcctt
ggccatatgcagcagggtggcaccccaacaccttttgatagaaactttgctaccaaaatg
ggtgccaaggctgttctctggctgacagaaaaactgaaggattgttatagacatgggcga
atctttgccaacaccccagactctgcatgtgtgttaggcatgaggaagagaggactggtg
ttacagcctctagctgaattgaaagaagagaccgattttgaacaccgtataccaaagagc
cagtggtggttaaagctgaggcctattatgaagatcctggccaagtacaagattaatctg
gacacctctgaacatgctctaatggagcacgttgtcagcaagaagcctccggtgcacatg
accctcacaaagtaa

DBGET integrated database retrieval system