KEGG   Danio rerio (zebrafish): 447905Help
Entry
447905            CDS       T01004                                 

Gene name
entpd2a.1, bZ1O1.2, si:rp71-1o1.2, zgc:101105
Definition
ectonucleoside triphosphate diphosphohydrolase 2a, tandem duplicate 1
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
dre  Danio rerio (zebrafish)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    447905 (entpd2a.1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     447905 (entpd2a.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
5
AA seq 502 aa AA seqDB search
MVSTGNRQQCQIITATGALFLAVGGILLLVLPSEDIKGSPGFMYGIVLDAGSSHTSMFIY
KWPADKQNGTGIVSQHSECHAKGGGISSYAGVKGGAARSLKECMDKAMREIPTVRYKHTP
VYLGATAGMRLLNISKPKESAEVLKEVEEKLKSYPFSFKGASILTGQEEGAYGWITVNYL
LENYIKYGFVGQWITPGRDTVGALDFGGASTQITFVTKQTVENKDDLMKLRLYGRDYQIY
THSFLCYGRDQVLLRLLAHLITIQGSDTSIIHPCYPADYSSSIKLSSVFGTPCVEKQTSY
NPDGELQIKGTGNYNQCLGNVSQLFSFSSCSYSKCSFDGVFQPNITGNFMAFSAFFYTHS
FLQEATGIKIWTPAHLEDAARVICNMSLQEMGKKSQDNESRLKDYCAVSVFVRALLVNGY
SFNDRTFPQISFQKKAGDTSVGWSLGYMLSLSNLLPAENVALKKSLRSGAWSFLIFLFSI
LLTSALIFLFRAICHKNKDDVV
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggtatccacgggcaacaggcagcaatgccagatcattactgccaccggggctctcttt
ctggcagtcggcgggattcttctgctcgtcctgccctctgaagacatcaaagggtcacca
ggctttatgtatggaatagttctggatgctggatcctctcatacgtccatgttcatctac
aaatggccagcagataagcagaacggcactggcattgtcagtcagcacagcgagtgccat
gcaaagggaggtgggatctcaagttatgctggtgtcaaaggaggagcagcaagaagcctt
aaggaatgcatggataaagccatgagggagattccaacagttagatacaaacacactcct
gtgtatctcggggccacagcgggcatgagactactaaatatttctaaacccaaagagtca
gctgaggttttgaaggaagtggaagaaaaactgaagagctacccattcagttttaaagga
gcctccatcttaactggacaagaggagggagcgtacggatggatcacagtcaactacctg
ctagagaactacattaagtatggttttgtgggtcagtggattactccaggcagagataca
gttggtgcgctggactttggcggagcgtctactcagatcacctttgtgacaaaacagacc
gtggagaacaaggatgacctgatgaaactgcggctgtacgggcgagactaccagatctac
actcacagttttctgtgttacggacgagatcaggttttgctccgactgctggcacatctg
atcacgattcagggttcagacacatctataatccacccctgttatcctgcagattacagc
agctctataaagctgagcagtgtgtttggtactccatgtgttgaaaaacaaacttcttac
aatcctgatggtgagctgcaaataaaaggcaccggaaactacaatcagtgtcttggaaat
gtgtctcaacttttctcctttagcagctgctcttattccaaatgctcttttgatggagtc
tttcagcccaacattactggaaacttcatggcattttcagcatttttctacacacattcc
tttcttcaggaagccacaggcatcaaaatctggactccagctcatttagaggacgctgct
cgtgtgatctgcaatatgagcttgcaggagatgggaaagaagagtcaggataatgaaagc
cgtctgaaggactactgtgcggtctctgtgtttgtgcgggcactcctggtcaatggatac
agtttcaacgatcgcaccttcccacaaatctcctttcagaagaaggcaggagacacgtct
gtcggctggtccctcggctacatgctaagcctaagcaatctgctgcctgccgaaaacgtt
gcactgaagaaatcgctgcgctcaggagcctggagttttctcatcttcctcttttccatc
ctccttacctcagcactaatctttctgtttcgagcaatctgccataaaaacaaagatgat
gtcgtttga

DBGET integrated database retrieval system