KEGG   Danio rerio (zebrafish): 449649Help
Entry
449649            CDS       T01004                                 

Gene name
galca, galc, galcl, si:ch211-199l3.4, zgc:92561
Definition
galactosylceramidase a (EC:3.2.1.46)
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
dre  Danio rerio (zebrafish)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    449649 (galca)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    449649 (galca)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     449649 (galca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 660 aa AA seqDB search
MQTHNFLCIIFVILGCSAQFYVIDDRIGLGREFDGIGGLSGGGATSRLLVNYEEPYRSQI
LDYLFKPNFGASLHILKVEIGGDAQTTDGTEPSHMHSKDEGNFFRGYEWWLMKEAKKRNP
NIKLIGLPWAFPGWVGYGTQWPYFFPNVTANYVITWVMGAKQHHNLDIDYIGIWNEKAFD
PTYIKVLRDVLDRAGFTNIGIIAADGDWSIASAMLDDPYLNDAVEVIGVHYPGTNTVKEA
LLTERKLWSSEDYSTYNDDIGAGCWARILNQNYVNGKMTSTISWNVIASYYENLSFGRDG
LMTAEEPWSGHYIVESPIWMTAHTTQFTQPGWFYLQTVGKLNHGGSYVALTDRKGNLTII
IETMTHEHSQCIRPPLPHFDVSPQIATFELKGSFAHLADLQVWYSKLDFKSGNGTLFRQL
RPIRAHNGLLSLKLDVDEVFTITTVTTAQRGFYPEPPKSCPFPKNYTDDFTIDNPPFSEA
PYFADQTGVFEYFRNTTDNSSHAFTLRQVVIERPVAWAKDADQTISIIGDYSWSDVNVSC
DVFIETPKTGGVFLAARVDQGGESVRQAKGVFYWIYANGTYRVTNDIGGKGVLAEGLSGT
KAGVWYTLTLSVKGYFATGSLNGFPLWKNAAVLEPKSGWAALGTLSFEYAQFDNFNVIAG
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgcacaattttctgtgcataatcttcgtcattctcggatgttcggctcagttt
tatgttatagatgatcggattggtttagggcgggagtttgatggaataggaggcttaagt
ggtggaggagccacttctcgacttcttgtcaattatgaagaaccctatcggagtcagata
ttggattacttattcaagcccaactttggagcttcacttcacatcctcaaggtagaaata
ggaggcgatgctcaaaccacagatggcacagaaccctctcacatgcacagtaaggatgag
gggaattttttccgtggatacgagtggtggcttatgaaggaagccaagaaaagaaatcca
aacattaagctgatcggtcttccctgggcatttcccggatgggttggatacggaacccaa
tggccttacttttttccaaatgttacagccaactatgttatcacatgggtcatgggagca
aagcagcatcataaccttgacattgattatatcgggatttggaatgagaaagcatttgat
ccgacatacattaaggtgctgagagatgttttggacagagctggcttcacgaatatcggc
atcattgctgcagatggagactggtctattgcgtctgccatgctggatgatccatatctg
aatgatgctgtcgaggtcataggtgtccactacccaggaaccaacacagtaaaggaagct
ctgttgacggagagaaagctctggtcatctgaagactacagcacctacaatgacgacatc
ggtgccggatgttgggctcgcattctcaaccagaactacgtgaatggcaaaatgacctcg
actatatcctggaatgtaatagcaagttattatgagaatctgtcatttggtagagatggt
ctgatgacggcagaggagccctggagtggacattatatagtggaatctccaatatggatg
actgctcacactactcaattcacacagccaggctggttttatctgcagactgtgggcaaa
ctcaaccacggaggaagttatgtggctttgacagaccgcaaagggaacttaacaattatt
atagaaaccatgacacacgagcactctcagtgcattcgtccaccattgccgcactttgac
gtctctcctcagatcgccacatttgagctcaaaggctcctttgcacatctcgctgacctt
caagtgtggtactcaaaactggattttaagtctggaaatggtacactgtttaggcaactg
aggcctattagggcccacaatggcttgttaagcttaaaactagatgtcgatgaggtcttt
actatcacaacggtcaccactgcgcaaagaggcttctacccagagccccccaaatcatgc
ccgttccctaagaattacaccgatgattttacaatagataaccctccattctctgaggcc
ccgtactttgctgatcaaaccggtgtgtttgagtacttcagaaacactacagataacagc
tcccatgcctttactcttcgccaagtggtcattgagcggccggtggcctgggctaaagat
gccgaccaaaccatcagcatcataggagactacagctggtcagacgtaaatgtgtcatgt
gatgtctttattgaaacccccaagactggaggagtgttcctggcggccagggtcgatcaa
ggcggagaatcagtccgacaagcaaagggggtcttttactggatttatgcaaatgggacc
tatagagtgacaaatgacataggtgggaaaggagttcttgctgaagggctgtcaggaaca
aaggcaggagtatggtacaccttaactcttagcgtcaagggatattttgccacagggtca
ctgaacggctttccgttgtggaaaaatgctgctgttctggagcccaagagtggttgggct
gcactaggaactttatcttttgaatacgcacagtttgataattttaatgtgattgcaggg
tga

DBGET integrated database retrieval system