KEGG   Danio rerio (zebrafish): 449649Help
Entry
449649            CDS       T01004                                 

Gene name
galca, galc, galcl, si:ch211-199l3.4, zgc:92561
Definition
galactosylceramidase a (EC:3.2.1.46)
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
dre  Danio rerio (zebrafish)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dre00600]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dre04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 660 aa AA seqDB search
MQTHNFLCIIFVILGCSAQFYVIDDRIGLGREFDGIGGLSGGGATSRLLVNYEEPYRSQI
LDYLFKPNFGASLHILKVEIGGDAQTTDGTEPSHMHSKDEGNFFRGYEWWLMKEAKKRNP
NIKLIGLPWAFPGWVGYGTQWPYFFPNVTANYVITWVMGAKQHHNLDIDYIGIWNEKAFD
PTYIKVLRDVLDRAGFTNIGIIAADGDWSIASAMLDDPYLNDAVEVIGVHYPGTNTVKEA
LLTERKLWSSEDYSTYNDDIGAGCWARILNQNYVNGKMTSTISWNVIASYYENLSFGRDG
LMTAEEPWSGHYIVESPIWMTAHTTQFTQPGWFYLQTVGKLNHGGSYVALTDRKGNLTII
IETMTHEHSQCIRPPLPHFDVSPQIATFELKGSFAHLADLQVWYSKLDFKSGNGTLFRQL
RPIRAHNGLLSLKLDVDEVFTITTVTTAQRGFYPEPPKSCPFPKNYTDDFTIDNPPFSEA
PYFADQTGVFEYFRNTTDNSSHAFTLRQVVIERPVAWAKDADQTISIIGDYSWSDVNVSC
DVFIETPKTGGVFLAARVDQGGESVRQAKGVFYWIYANGTYRVTNDIGGKGVLAEGLSGT
KAGVWYTLTLSVKGYFATGSLNGFPLWKNAAVLEPKSGWAALGTLSFEYAQFDNFNVIAG
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgcacaattttctgtgcataatcttcgtcattctcggatgttcggctcagttt
tatgttatagatgatcggattggtttagggcgggagtttgatggaataggaggcttaagt
ggtggaggagccacttctcgacttcttgtcaattatgaagaaccctatcggagtcagata
ttggattacttattcaagcccaactttggagcttcacttcacatcctcaaggtagaaata
ggaggcgatgctcaaaccacagatggcacagaaccctctcacatgcacagtaaggatgag
gggaattttttccgtggatacgagtggtggcttatgaaggaagccaagaaaagaaatcca
aacattaagctgatcggtcttccctgggcatttcccggatgggttggatacggaacccaa
tggccttacttttttccaaatgttacagccaactatgttatcacatgggtcatgggagca
aagcagcatcataaccttgacattgattatatcgggatttggaatgagaaagcatttgat
ccgacatacattaaggtgctgagagatgttttggacagagctggcttcacgaatatcggc
atcattgctgcagatggagactggtctattgcgtctgccatgctggatgatccatatctg
aatgatgctgtcgaggtcataggtgtccactacccaggaaccaacacagtaaaggaagct
ctgttgacggagagaaagctctggtcatctgaagactacagcacctacaatgacgacatc
ggtgccggatgttgggctcgcattctcaaccagaactacgtgaatggcaaaatgacctcg
actatatcctggaatgtaatagcaagttattatgagaatctgtcatttggtagagatggt
ctgatgacggcagaggagccctggagtggacattatatagtggaatctccaatatggatg
actgctcacactactcaattcacacagccaggctggttttatctgcagactgtgggcaaa
ctcaaccacggaggaagttatgtggctttgacagaccgcaaagggaacttaacaattatt
atagaaaccatgacacacgagcactctcagtgcattcgtccaccattgccgcactttgac
gtctctcctcagatcgccacatttgagctcaaaggctcctttgcacatctcgctgacctt
caagtgtggtactcaaaactggattttaagtctggaaatggtacactgtttaggcaactg
aggcctattagggcccacaatggcttgttaagcttaaaactagatgtcgatgaggtcttt
actatcacaacggtcaccactgcgcaaagaggcttctacccagagccccccaaatcatgc
ccgttccctaagaattacaccgatgattttacaatagataaccctccattctctgaggcc
ccgtactttgctgatcaaaccggtgtgtttgagtacttcagaaacactacagataacagc
tcccatgcctttactcttcgccaagtggtcattgagcggccggtggcctgggctaaagat
gccgaccaaaccatcagcatcataggagactacagctggtcagacgtaaatgtgtcatgt
gatgtctttattgaaacccccaagactggaggagtgttcctggcggccagggtcgatcaa
ggcggagaatcagtccgacaagcaaagggggtcttttactggatttatgcaaatgggacc
tatagagtgacaaatgacataggtgggaaaggagttcttgctgaagggctgtcaggaaca
aaggcaggagtatggtacaccttaactcttagcgtcaagggatattttgccacagggtca
ctgaacggctttccgttgtggaaaaatgctgctgttctggagcccaagagtggttgggct
gcactaggaactttatcttttgaatacgcacagtttgataattttaatgtgattgcaggg
tga

DBGET integrated database retrieval system